Os04g0287400

Please input one-sentence summary here.

Annotated Information

Introduction

Schematic diagrams of conserved motifs found in the OsWRKY51 peptide sequences.WRKY motif; zinc finger, zinc finger motif; NLS, putative nuclear localization motif; HARF, conserved motif only found in a subgroup of WRKY proteins; LXXLL, putative co-activator motif; Lx, putative active repressor motif with the LXLXLX consensus sequences; SUMO, putative sumoylation motif; LZ, putative Leu-zipper motif.

The gene symbol is OsWRKY51, and other log number are that NCBI GeneBank：BK005053, RAP-DB：Os04g0287400 and MSU：LOC_Os04g21950. OsWRKY51 belongs to the WRKY family which encodes transcription factors that are involved in the regulation of various biological processes. OsWRKY51 encodes a group II WRKY protein contains one WRKY domain initially defined by a nearly 60 amino acid long motif with a C2H2-type zinc finger motif. The pattern of potential zinc ligands(C-X4-5-C-X22-23-H-X1-H)is unique among all described zinc-finger-like motifs. Nevertheless, experimental evidence has shown OsWRKY51 can bind sequence specifically to various W box elements (T)(T)TGAC(C/T) containning the invariant TGAC core which is essential for function and WRKY binding. The figure OsWRKY51 CONSTYUCT shows the concrete motifs of OsWRKY51.

Function

Proposed roles for OsWRKY51 and OsWRKY71 in modulating the cross-talk of giberellin (GA) and abscisic acid (ABA)signaling. Filled ovals represent OsWRKY51 and OsWRKY71; the open oval represents GAMYB. Open squares represent cis-acting elements in the low pI α-amylase promoter: W, W-box; GARE, GA-responsive element. Arrows represent induction and T-bars denote repression.

The dosage experiment was carried out with a constant amount of the reporter construct (Amy32b-GUS) and varied amounts of the effector construct(s) in the presence of 1 lM GA3 for 24 h. The relative amount of effector construct is indicated as a percentage compared to the amount of reporter.

Recently,two ABA-inducible and gibberellin (GA)-repressible rice WRKY genes are identified, namely OsWRKY51 and -71.Although OsWRKY51 itself does not bind to the Amy32b promoter in vitro, it interacts with OsWRKY71 and enhances the binding affinity of OsWRKY71 to W boxes in the Amy32b promoter. Titration experiments suggest that the ratio of repressors (such as OsWRKY51 and OsWRKY71) to the activator (e.g. OsGAMYB) seems to determine the expression level of the Amy32b promoter. These data demonstrate the synergistic interaction of ABA-inducible WRKY genes in regulating GAMYB-mediated GA signaling in aleurone cells, thereby establishing a novel mechanism for ABA and GA signaling cross talk.A model is proposed for the role of OsWRKY51 and OsWRKY71 in mediating the cross-talk of GA and ABA signaling. The OsWRKY51/OsWRKY71 repressors form a heterotetramer to bind the W-boxes, thus exerting an antagonistic effect against GA induction of Amy32b. In contrast, GA induces GAMYB, but suppresses OsWRKY51 and OsWRKY71. The ratio of OsWRKY51/OsWRKY71 to GAMYB is low, so that GAMYB competes against the inhibitory effect of OsWRKY51 and OsWRKY71, leading to a high level of α-amylase gene expression. Obviously, this is an over-simplified model because it does not consider other activators, such as OsDOF3, RAMY, and OsMYBS1/OsMYBS2, as well as other repressors, such as KGM (for kinase associated with GAMYB; Woodger et al. 2003) and HRT(for Hordeum repressor of transcription; Raventós et al. 1998).Nevertheless, this model gives us new insights about how multiple transcription factors coordinate to fine tune Amy32b expression triggered by different signals. 　　To study the combinatory effect of these two repressors, dosage experiments were performed for OsWRKY51 alone, OsWRKY71 alone, and OsWRKY51 with OsWRKY71(resulta). The results indicated that co-expression of UBI-OsWRKY51 at the 1% (effector/reporter) ratio had no suppression activity on the GA induction of Amy32b-GUS. Co-expression of 1% UBI-OsWRKY71 suppressed the GA induction of Amy32b-GUS to 91% of the control. Interestingly, co-expression of 1% UBI-OsWRKY51 plus 1% UBI-OsWRKY71 strongly reduced the GA induction of Amy32b-GUS to 25% of the control (resultb). It is important to point out that this increased effect is unlikely to be due to twice as much effector DNA in the mixture. In fact, the reporter expression level resulting from 1% UBI-OsWRKY51 plus 1%UBI-OsWRKY71 was even lower than that for 2.5%, 5%, 7.5% or 10% UBI-OsWRKY51 or UBI-OsWRKY71 alone. These results suggest that the effect of OsWRKY51 and OsWRKY71 is not additive, but they synergistically act to suppress the GA induction of Amy32b.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name	Os04g0287400
Description	Similar to WRKY transcription factor 51
Version	NM_001058916.1 GI:115457561 GeneID:4335388
Length	1399 bp
Definition	Oryza sativa Japonica Group Os04g0287400, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 4
Location	Chromosome 4:12561659..12563057
Sequence Coding Region	12561842..12562022,12562107..12562232,12562301..12562974
Expression	GEO Profiles:Os04g0287400
Genome Context	<gbrowseImage1> name=NC_008397:12561659..12563057 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008397:12561659..12563057 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atgattaccatggatctgatgggtgggtacgggcgggtggacgagcaggtggccatccaggaggcggcggcggcggggctaagggggatggagcatcttattctgcagctgtcccagactgggacgagcgagaggtcgccggcgccggcgcaggagcagcagcaacaggtggactgcagggagatcacggacatgacggtgtccaagttcaagaaggtgatctccatgctgaaccgcaccggccacgcgcggttccggcggggcccggtggtggcgcagtcgtcgggcccggcggcgtccgagccggcgccggtgaggtcgtccccgtcggcggtgtcgaggcccatgacgctcgacttcaccaaggcggcgtccgggtacggcaaggacgccgggttcagcgtctccggcatctccgccgcgagctcgtccttcctctcgtcggtcaccggcgacggcagcgtgtccaacgggcgcggcggcgggtcatcctccctgatgcttcccccgccgccggcgaccagctgcggcaagccaccgctgtcctccgccgccgccgccatgtcagccggcgcaggccacaagcgcaagtgccacgaccacgcgcactccgagaacgtcgccggcggcaagtacggatccaccggcggccgctgccactgctccaagcgccggaagcatcgggtgaagaggacgatccgcgtgccggcgataagctcgaaggtggcggacatccccgccgacgacttctcgtggcggaagtacgggcagaagcccatcaagggctcccccttcccacgaggatactacaagtgtagcacgctgcgcggttgcccggcgaggaagcacgtggagcgcgacccgaccgacccgtccatgctcatcgtcacctacgagggcgagcaccgccactccccctccgccgccggccaggaccacccgccggcgccgcctccgccgctggcgctgccgctcgcctga</cdnaseq>
Protein Sequence	<aaseq>MITMDLMGGYGRVDEQVAIQEAAAAGLRGMEHLILQLSQTGTSE RSPAPAQEQQQQVDCREITDMTVSKFKKVISMLNRTGHARFRRGPVVAQSSGPAASEP APVRSSPSAVSRPMTLDFTKAASGYGKDAGFSVSGISAASSSFLSSVTGDGSVSNGRG GGSSSLMLPPPPATSCGKPPLSSAAAAMSAGAGHKRKCHDHAHSENVAGGKYGSTGGR CHCSKRRKHRVKRTIRVPAISSKVADIPADDFSWRKYGQKPIKGSPFPRGYYKCSTLR GCPARKHVERDPTDPSMLIVTYEGEHRHSPSAAGQDHPPAPPPPLALPLA</aaseq>
Gene Sequence	<dnaseqindica>1036..1216#826..951#84..757#acttcttcttcttcttcttccccccatttctcacttactccggcgatcaccgtggttgagcgtcggcggcggaggaggaggcgatgattaccatggatctgatgggtgggtacgggcgggtggacgagcaggtggccatccaggaggcggcggcggcggggctaagggggatggagcatcttattctgcagctgtcccagactgggacgagcgagaggtcgccggcgccggcgcaggagcagcagcaacaggtggactgcagggagatcacggacatgacggtgtccaagttcaagaaggtgatctccatgctgaaccgcaccggccacgcgcggttccggcggggcccggtggtggcgcagtcgtcgggcccggcggcgtccgagccggcgccggtgaggtcgtccccgtcggcggtgtcgaggcccatgacgctcgacttcaccaaggcggcgtccgggtacggcaaggacgccgggttcagcgtctccggcatctccgccgcgagctcgtccttcctctcgtcggtcaccggcgacggcagcgtgtccaacgggcgcggcggcgggtcatcctccctgatgcttcccccgccgccggcgaccagctgcggcaagccaccgctgtcctccgccgccgccgccatgtcagccggcgcaggccacaagcgcaagtgccacgaccacgcgcactccgagaacgtcgccggcggcaagtacggatccaccggcggccgctgccactgctccaagcgccggtaaaaatcttcacgactccctccatttcccccacctcgaattgaactcatcggaattaattttccaggaagcatcgggtgaagaggacgatccgcgtgccggcgataagctcgaaggtggcggacatccccgccgacgacttctcgtggcggaagtacgggcagaagcccatcaagggctcccccttcccacggtgagcaccgcactgccccgccgtctctcctcactccgtcgacattaacactcaaaactaatcgtaatcccctcatttttgcagaggatactacaagtgtagcacgctgcgcggttgcccggcgaggaagcacgtggagcgcgacccgaccgacccgtccatgctcatcgtcacctacgagggcgagcaccgccactccccctccgccgccggccaggaccacccgccggcgccgcctccgccgctggcgctgccgctcgcctgagatacccccggtgaagaagagtgagaattagcttgtcggtcatcataattaccgttagaaattatttttttcgtttttctctctttttttttcttttttttactgcatcattgtagaactagcgtgtaaaacaattttaggagactttgagactgagcttttactgaagaaaaaataaagcag</dnaseqindica>
External Link(s)	NCBI Gene:Os04g0287400, RefSeq:Os04g0287400