Os04g0572400

From RiceWiki
Revision as of 12:42, 7 June 2014 by Helen (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Most dehydration-responsive element-binding (DREB) factors interact specifically with the dehydration-responsive element (DRE) and control the expression of many stress-inducible genes in Arabidopsis. OsDREB are homologous to Arabidopsis DREB genes. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice. Transgenic rice plants analysis revealed that over-expression of OsDREB1G and OsDREB2B in rice significantly improved their tolerance to water deficit stress, while over-expression of OsDREB1E could only slightly improved the tolerance to water deficit stress, suggesting that the OsDREBs might participate in the stress response pathway in different manners (Chen et al. 2008).

OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element. OsDREB4-1 and OsDREB4-2 proteins specifically bound to DRE and activated expression of the dual reporter genes of histidine (HIS3) and galactosidase (LacZ). OsDREB4-1 could function as a trans -acting factor in the DRE/DREB regulated stress-responsive pathway. The expression of the OsDREB genes could be controlled by specific aspects of differentiation or development (Tian et al. 2005).

Expression

In rice, OsDREB1A and OsDREB2A can specifically bind to the DRE element, and the OsDREB1A preferentially binds to GCCGAC than to ACCGAC whereas the AtDREB1A protein binds more efficiently to both GCCGAC and ACCGAC (Chen et al. 2003). The DNA-binding specificity of OsDREB4 had also been studied and the results indicated that OsDREB4 could specifically bind to DRE element (Tian et al. 2005).

In rice seedlings, expression of OsDREB4-1 was induced by dehydration and high salt, whereas OsDREB1-1 and OsDREB4-2 were expressed constitutively. Under normal growth conditions, OsDREB1-1 was expressed strongly in the leaf, sheath, and spike, was expressed relatively weak in the stem and only faintly expressed in the roots, whereas expression of transcripts of OsDREB4-1 and OsDREB4-2 was higher in the roots, stem, and spike, lower in the leaf, and undetectable in the sheath (Tian et al. 2005). .

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1. Department of Plant Science, College of Biological Sciences, China Agricultural University, Beijing 100094, China;

2. Plant Biotechnology Laboratory, Institute of Genetics and Developmental Biology, the Chinese Academy of Sciences, Beijing 100101, China

3. College of Life Sciences, Beijing Normal University, Beijing 100875, China

4. chool of Life Sciences, Fudan University, Shanghai 200433, China

5. National Center for Molecular Crop Design, Weiming Kaituo Agriculture Biotech Co., Ltd, Beijing 100085 ,China

References

1. Chen J Q, Meng X P, Zhang Y, et al. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice[J]. Biotechnology letters, 2008, 30(12): 2191-2198.

2. Tian X H, Li X P, Zhou H L, et al. OsDREB4 Genes in Rice Encode AP2‐Containing Proteins that Bind Specifically to the Dehydration‐Responsive Element[J]. Journal of Integrative Plant Biology, 2005, 47(4): 467-476.

Structured Information

Gene Name

Os04g0572400

Description

Similar to CRT/DRE binding factor 1

Version

NM_001060143.1 GI:115460015 GeneID:4336721

Length

660 bp

Definition

Oryza sativa Japonica Group Os04g0572400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:29219354..29220013

Sequence Coding Region

29219354..29220013

Expression

GEO Profiles:Os04g0572400

Genome Context

<gbrowseImage1> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</cdnaseq>

Protein Sequence

<aaseq>MEWAYYGSGYSSSGTPSPVGGDGDEDSYMTVSSAPPKRRAGRTK FKETRHPVYKGVRSRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAAMALRGR AACLNFADSPRRLRVPPLGAGHEEIRRAAVEAAELFRPAPGQHNAAAEAAAAVAAQAT AASAELFADFPCYPMDGLEFEMQGYLDMAQGMLIEPPPLAGQSTWAEEDYDCEVNLWS Y</aaseq>

Gene Sequence

<dnaseqindica>1..660#atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0572400, RefSeq:Os04g0572400