Os08g0167500
Please input one-sentence summary here. The rice gene Os08g0167500 was reported as CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex, is essential for photorespiration in Orazy sativa Japonica Group.
Contents
Annotated Information
Hua Pu(蒲华)from Institute of Botany, Chinese Academy of Science.
Function
Please input function information here. The role of NAD(P)H dehydrogenase (NDH)‐dependent cyclic electron flow around photosystem I in photosynthetic regulation and plant growth at several temperatures was examined in rice (Oryza sativa) that is defective in CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex (crr6). NdhK was not detected by Western blot analysis in crr6 mutants, resulting in lack of a transient post‐illumination increase in chlorophyll fluorescence, and confirming that crr6 mutants lack NDH activity. When plants were grown at 28 or 35°C, all examined photosynthetic parameters, including the CO2 assimilation rate and the electron transport rate around photosystems I and II, at each growth temperature at light intensities above growth light (i.e. 800 μmol photons m−2 sec−1), were similar between crr6 mutants and control plants. However, when plants were grown at 20°C, all the examined photosynthetic parameters were significantly lower in crr6 mutants than control plants, and this effect on photosynthesis caused a corresponding reduction in plant biomass. The Fv/Fm ratio was only slightly lower in crr6 mutants than in control plants after short‐term strong light treatment at 20°C. However, after long‐term acclimation to the low temperature, impairment of cyclic electron flow suppressed non‐photochemical quenching and promoted reduction of the plastoquinone pool in crr6 mutants. Taken together, our experiments show that NDH‐dependent cyclic electron flow plays a significant physiological role in rice during photosynthesis and plant growth at low temperature.
Expression
Please input expression information here. Rice crr6 mutants do not accumulate the NDH complex. CRR6 is a stromal protein that is required for the assembly of NDH sub-complex A in Arabidopsis (Peng et al., 2010), and is encoded by a single-copy gene (Os08g0167500) in rice. The Tos17 retrotransposon was inserted into the exon of this gene (OsCRR6). Homozygous Tos17 insertion plants were identified by PCR analysis from progeny of a heterozygous plant provided by the National Institute of Agrobiological Sciences of Japan. As Tos17 mutant lines may include multiple insertions in a single genome, the crr6 mutant plant was crossed with the wild-type, and the resulting plants containing the homo-zygous wild-type CRR6 allele were used as control plants (+/+) in the experiments described below . As the control plants behaved like wild-type plants in all experi-ments, we describe differences between crr6 mutants and the control plants (+/+). The fact that the TOS17 insertioncaused the mutant phenotype was further confirmed in the generation (see below). Immunoblot analysis showed that CRR6 was not present in crr6 mutants (Figure 1c). The chloroplast NDH complex is divided into four parts (the A, B, membrane and lumen sub-complexes; Peng et al., 2008, 2011), and CRR6 is required for accumulation of subcomplex A in Arabidopsis (Peng et al.,2008). To study the effect of disruption of CRR6 on accumu-lation of the NDH complex in rice, we assessed the level of NdhK, a subunit of sub-complex A of the NDH complex, in crr6 mutants (Figure 1c). The NdhK level was drastically reduced to below the detection limit in crr6 mutants. Thus,consistent with observations in Arabidopsis (Peng et al.,2010), accumulation of NDH sub-complex A was impaired in rice crr6 mutants.
Evolution
Please input evolution information here. Gene ID: 4344752 Gene symbol:Os08g0167500 Gene description:Os08g0167500 Gene type:protein coding RefSeq status:PROVISIONAL Organism:Oryza sativa Japonica Group (cultivar: Nipponbare) Lineage:Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here. Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Aoba-ku, Sendai 981-8555, Japan Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502, Japan
References
Please input cited references here.
Wataru Yamori;Naoki Sakata;Yuji Suzuki;Toshiharu Shikanai;Amane Makino Cyclic electron flow around photosystem I via chloroplast NAD(P)H dehydrogenase (NDH) complex performs a significant physiological role during photosynthesis and plant growth at low temperature in rice The Plant Journal, 2011, 68(6): 966-976
Structured Information
| Gene Name |
Os08g0167500 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001067614.1 GI:115474964 GeneID:4344752 |
| Length |
2049 bp |
| Definition |
Oryza sativa Japonica Group Os08g0167500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:3948087..3950135 |
| Sequence Coding Region |
3948167..3948377,3949066..3949200,3949289..3949497,3949605..3949811 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:3948087..3950135 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:3948087..3950135 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccgccaccgcactccaactcccagtggccagctcgcaacgtctgacgctgaggcgtttccccggcagcggctcgttgggtcggtactctgggttgcggtggcccgtcgcggcgcaggcgaggagggcggcggaggaggggtttcgtctccgtgtcgcgttcaacccctccgggaacttcgacctctccctctccaccgaccaagacgatgccccacaagttgagcctccaccaccacctacagaaggtcgctttgagattgtcatcaacaccgatatcatccggacgctcgacctttcgcctgttcatgaagtacttggtgacttgaattccctgacaccagctcaaacaagaaatctcttggatcgaacggtcgggtttactataaactatgagagggaggatccatatgatgtgagggagctgtcagagttccctgatataaggctatggtttgtgaggcttgatgcttgttacccttggttccctgttgtgcttgattggagagctggtgaacttgccagatatgccgcaatgctggcccctcaccagatgagcatgaggcttggtgtggtcttcaacccggaggcgctggagctgtttgtgatgaagaaggtgttcattgtttactcatggctaaagcagcaggaacatcctaaacctggactcaagacggctgacatggccaggatgcttggtttcggtataggagatgaattattcgacttgattgagaagtatcctgctggtccttcatga</cdnaseq> |
| Protein Sequence |
<aaseq>MAATALQLPVASSQRLTLRRFPGSGSLGRYSGLRWPVAAQARRA AEEGFRLRVAFNPSGNFDLSLSTDQDDAPQVEPPPPPTEGRFEIVINTDIIRTLDLSP VHEVLGDLNSLTPAQTRNLLDRTVGFTINYEREDPYDVRELSEFPDIRLWFVRLDACY PWFPVVLDWRAGELARYAAMLAPHQMSMRLGVVFNPEALELFVMKKVFIVYSWLKQQE HPKPGLKTADMARMLGFGIGDELFDLIEKYPAGPS</aaseq> |
| Gene Sequence |
<dnaseqindica>81..291#980..1114#1203..1411#1519..1725#gttgcgtctcccgccgcggtgacctcacctctcttcctcgccgccggcggccgcgcgtccatcgcgtcgccgtcgccgccatggccgccaccgcactccaactcccagtggccagctcgcaacgtctgacgctgaggcgtttccccggcagcggctcgttgggtcggtactctgggttgcggtggcccgtcgcggcgcaggcgaggagggcggcggaggaggggtttcgtctccgtgtcgcgttcaacccctccgggaacttcgacctctccctctccaccgaccaagacggtgagcgactaggagtaaaaactactgccaatttggaaataaatttctccatggagagcggttgaaaaccaaaattccgtattttattcagttttgtgtttgagtttgaaaactatataattttctgtagtaagacaatactactgacttgtttttttttcttccattgctaactattacagtgcaccgtcaatctgctacatatgagtatctgactgagatgattgactcttagtgaagttacatcaaccatcacagttgataaccatcgcagttgatgtgcaaattgcaagaatactaatcttgttatgactaaaacatttgagcttttcactcaatcgtttgattcagtcaaagatgttctcaaacttcaattgcatgggagggatgtggcttggaaatgcctaattaaccacagggtggttcatttatgtgaaaccctgtttattggttgctagaggttccctgaagggtaaaagttgttattatgcttgaaacaaagcaagggtggaagtgattttatttcttcatgctgggttgacctcatgttacctagtaaaatttgttacaattaaaactttatttgttgcctatcagtcgttctgtgtgtataatatgcacctgttccttgatttggtaaatccatttcttttgcttgcaaatgacaatcttcgacggcttgctgtagatgccccacaagttgagcctccaccaccacctacagaaggtcgctttgagattgtcatcaacaccgatatcatccggacgctcgacctttcgcctgttcatgaagtacttggtgacttgaattccctgacaccaggtgcgcaacaatgaaagtcatgacattgtattgtttcaacagtcaattccatgttatagttaacaagaatcttatgtgtatcattcagctcaaacaagaaatctcttggatcgaacggtcgggtttactataaactatgagagggaggatccatatgatgtgagggagctgtcagagttccctgatataaggctatggtttgtgaggcttgatgcttgttacccttggttccctgttgtgcttgattggagagctggtgaacttgccagatatgccgcaatgctggcccctcaccaggtaacaagatataacctgaattttgcatccccaaataatttggtcctacatatacttccatgtcgttttggagtttaagatgaattcatatttgcaaaaatctgcagatgagcatgaggcttggtgtggtcttcaacccggaggcgctggagctgtttgtgatgaagaaggtgttcattgtttactcatggctaaagcagcaggaacatcctaaacctggactcaagacggctgacatggccaggatgcttggtttcggtataggagatgaattattcgacttgattgagaagtatcctgctggtccttcatgaatctatctccataacctagagaattttgtcaataataggcatcacatcatacctttttcttttttttttaagcatcacccggggcgaaatgctcacctgaatatggattacatcatactgaatcaaatgataactgttttcagtcgtctgggctttgctatatgttgttgttgtctacaggaaacaattcaatgtgtaaatagtgccaaagaaatcaaattttagctcaggagtacagtttgagattttgcttctggtgctagtaactttgtaagctcctgcaactgtgatatgaatataattttgccactaacgccttgcttg</dnaseqindica> |
| External Link(s) |