Os08g0105000

From RiceWiki
Revision as of 03:31, 8 June 2014 by QingweiTian (talk | contribs)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

A number of genes individually controlling number of grains per plant, heading date and plant height have been cloned recently using map-based cloning approaches. Compared with the genes reported previously, Ghd7 is notable in that it has large pleiotropic effects on an array of traits, including grain number,heading date and plant height. Such pleiotropic effects may provide an explanation for QTL hot spots that were observed in many studies. CCT-domain proteins have been reported to have crucial roles in regulating processes such as photoperiodic flowering, vernalization31, circadian rhythms and light signaling. The results of the present study indicate that GHD7 has a key role in photoperiod flowering by regulating the putative Ehd1-Hd3a pathway. Strong expression of Ghd7 in the vascular tissues of leaves is consistent with the role of CO-like genes in flowering regulation. However, we also observed expression of Ghd7 in organs that may not be directly related to photoperiod-controlled flowering, such as roots that do not seem to have a role in flowering, leaves and meristems in the early seedling stage that are much too early for flower induction, and the stems and panicles that already passed the stage of phase transition. Expression in these tissues corresponded well with increases in the various organs leading to an overall increase in plant size, suggesting the possibility that this gene may have a general role in promoting growth, cell proliferation and differentiation, in addition to photoperiod flowering. Ghd7 controls heading date through its enhanced expression under long-day conditions to repress the expression of Hd3a, likely through Ehd1, thus delaying flowering. Of note, the cereal VRN2 gene, although referred to as a vernalization gene, actually has a day-length control and is only expressed under long-day conditions, when it acts as a repressor of flowering. VRN2 was classified in the same CCT subfamily as Ghd7. This suggests that tropical short-day plants that do not use vernalization as a flowering cue, and temperate long-day plants that do use vernalization, actually use related genes to repress flowering in long-day conditions. Such similarity in flowering control provides important clues as to how the temperate cereals might have evolved. Moreover, these genes also act as major sources of adaptive variation, and hence are keys to understanding the spread and success of cereals. Sequence analysis of allelic variants at theGhd7 locus indicated that this locus has contributed greatly to both productivity and adaptability of cultivated rice on a global scale. Asian cultivated rice originated in tropical and subtropical regions of Asia. The functional alleles with strong effects (for example,Ghd7-1 andGhd7-3) allow rice plants to fully exploit light and temperature by delaying flowering under long-day conditions in areas with long growing seasons, thus producing large panicles and increasing yield. The mutations giving rise to the Ghd7-0 and Ghd7-2 alleles, with no or reduced effect of delaying heading under long-day conditions, have had crucial roles by enabling rice to be cultivated under conditions with short growth duration and/or temperate regions. Additionally, the substantial dominant effect observed in the heterozygote between NIL(zs7) and NIL(mh7) indicated that theGhd7 locus has also contributed significantly to the highlevel of heterosis of Shanyou 63 (refs. 19,40), a widely cultivated hybrid in China in the last more than 20 years. Yield has been generally regarded as a complex trait that is controlled by multiple genes of small effects. The major effects demonstrated by the NILs and transgenic plants and the cloning of this QTL have fundamental implications for yield improvement,suggesting that yield, like other traits, can also be improved by individually manipulating the component traits using both molecular marker–assisted selection and transformation.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os08g0105000

Description

Zinc finger, PHD-type domain containing protein

Version

NM_001067318.1 GI:115474372 GeneID:4344443

Length

4125 bp

Definition

Oryza sativa Japonica Group Os08g0105000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:271854..275978

Sequence Coding Region

272583..273512,273602..273646,273832..273921,274832..275152,275242..275445
,275590..275691

Expression

GEO Profiles:Os08g0105000

Genome Context

<gbrowseImage1> name=NC_008401:271854..275978 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:271854..275978 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggctcccagaaccgccccccaccaccgcgcaagaggcagccgccgccgccggaggaccacctcgtcacctacaagcgccgccgctccaaagaaacacagcctttgccactcatggccaacggcgccaattctaagaaagacgccaaggcccaacattggattagctggagggacactctccacggcttcctccaatcccctgctattagccagggtggaggaattcagacctgcatccgtcatgctctccaacacaatccttgcttgctcaccaatggtgttgttgttcacactgaattcaaaggtaacccagctcattcccaaggagaggaagcaaaagtgcagcaccctaatggtgctgctggaggcaaggtggtttctgcagatgctgctatacaagatgcggctgccgcagcttcttccgaagctaacaaggcaatgtgtaataatgccctcttcgacattttggtctcccagaaatttgccttgttgtgccatttgctacttgggaccttccatgtcaataaacctggtgatgtcatcgacttggaaaaaatcgacgccaagatgagaaatggagactatgcccacaaccctgcactatttgacgatgatatccagcagatgtgggagaagtttgagcaagttggccaagagatgacaggtctagcgagcaacctttcaaccatttcacgagtttcataccaaaagcaggcttctggattttctgaagctgaggtggctgagcacagaatagaggaaataagtttgccgggtgctgtccacgttgtcacaaaggagtcgactaccaccgtgcagttggccccatgtgattctagtcattctacaataccgaaacgaactgtgccacctggacgtgatctgtgcccttgcgatggttgtggcaccaaggtagatgttgaagaaggcctaatctgtgatgaatgtgacaccatgtaccactttgcatgtgtcaagctactcaatcctgatattaagcaagtcccagcaatctggcattgttcaacctgcagcttcaagaaaaaagaattggctgcagataccacgaataatgttgcccatgactgcttgcatggtggtaactgtgttttgtgtgaccagctcgagctggtgaagacagaagaagaagatcccaagcttcccataaaaattgaattagctgaagaaagagaggggagctccgtctcaagcatgggggaagacaatgaaccagacctgtcaacaactgccctgtcaaacttgtgcaaacactgtggcacatgcgaagacgatgacaagagattcatggtatgcggacatccttactgcgtttacaagttctatcatatccgatgcctgaaaacaagccagcttgcaattgagcaacaaaagaagcttggttgctggtactgcccctcttgcctctgcagagggtgcttccaagacaaggatgatgaccagatagtcatgtgtgatggctgtgatgaaggttatcacatatattgcatgagaccagcacgcaacactatccccaaaggtaagtggtactgtacattttgcaagatccgcagggcagcggaaggaatgcataagtatgaggattctgtgctgaaaatacatgggaatagtaagcatgcttgtaatgtgaatcagtcgaaggattctgaaggtgatggtactgaaaagtga</cdnaseq>

Protein Sequence

<aaseq>MGSQNRPPPPRKRQPPPPEDHLVTYKRRRSKETQPLPLMANGAN SKKDAKAQHWISWRDTLHGFLQSPAISQGGGIQTCIRHALQHNPCLLTNGVVVHTEFK GNPAHSQGEEAKVQHPNGAAGGKVVSADAAIQDAAAAASSEANKAMCNNALFDILVSQ KFALLCHLLLGTFHVNKPGDVIDLEKIDAKMRNGDYAHNPALFDDDIQQMWEKFEQVG QEMTGLASNLSTISRVSYQKQASGFSEAEVAEHRIEEISLPGAVHVVTKESTTTVQLA PCDSSHSTIPKRTVPPGRDLCPCDGCGTKVDVEEGLICDECDTMYHFACVKLLNPDIK QVPAIWHCSTCSFKKKELAADTTNNVAHDCLHGGNCVLCDQLELVKTEEEDPKLPIKI ELAEEREGSSVSSMGEDNEPDLSTTALSNLCKHCGTCEDDDKRFMVCGHPYCVYKFYH IRCLKTSQLAIEQQKKLGCWYCPSCLCRGCFQDKDDDQIVMCDGCDEGYHIYCMRPAR NTIPKGKWYCTFCKIRRAAEGMHKYEDSVLKIHGNSKHACNVNQSKDSEGDGTEK</aaseq>

Gene Sequence

<dnaseqindica>2467..3396#2333..2377#2058..2147#827..1147#534..737#288..389#agtttccattcccgttccgttataataagaggagagagagagagattttgggtttgtctccggctccgctcgccgcctccaaatcccgctcctccgctgctgctcctctctgccgcggcgaggcgagagatccgaatccaccgccacccgcgcccaccccgcccgcacaaaccctagtttttccggggttttgcttcccctccgcagctccgctccgctccgtccgtcgtctcctcccggcggctcggcttgctgtccatgctgtagccgccccccgcaggtggctgatgggctcccagaaccgccccccaccaccgcgcaagaggcagccgccgccgccggaggaccacctcgtcacctacaagcgccgccgctccaaagaaacacaggtaaccaaccaaccaactccctgcctcttcttcttcttctttctccagatttcctttcgatttctacaagattcgtactctcgcttcttgcctcctcttacaatctctcattacatctacttgttgtgctttcttttcttgcagcctttgccactcatggccaacggcgccaattctaagaaagacgccaaggcccaacattggattagctggagggacactctccacggcttcctccaatcccctgctattagccagggtggaggaattcagacctgcatccgtcatgctctccaacacaatccttgcttgctcaccaatggtgttgttgttcacactgaattcaaagtaacacacaccacctttgtttgcatctaccctatatatatttatgcaatgataattttcctaacacatgacttctttctcattaccagggtaacccagctcattcccaaggagaggaagcaaaagtgcagcaccctaatggtgctgctggaggcaaggtggtttctgcagatgctgctatacaagatgcggctgccgcagcttcttccgaagctaacaaggcaatgtgtaataatgccctcttcgacattttggtctcccagaaatttgccttgttgtgccatttgctacttgggaccttccatgtcaataaacctggtgatgtcatcgacttggaaaaaatcgacgccaagatgagaaatggagactatgcccacaaccctgcactatttgacgatgatatccagcaggtaattgtttctctattgctcccatgaaagtaatttagctactgttgttggagggaaataatactagctagtgtttattcttatcttttatctaataaagatgatgcatattacctgtacttataagcgccctctgtatgctaaagcttaatgtgttctccatctattattgttcacaactccgtaaatcataagagcaaaatgttctacgtacggccagttgatagaatgatgctgatgctcaactgcttatctgagcttcttttgcgtttgctagttaagatcttcccaaattgtttgaaccatccaagcaacagactcctagggagtttatcacaactgaccttctagaactctggttgttagggttggaacgctagtcaacttaaatggtatactagccctgtttctacactatcatgtcttcgcaactttatatgctctatttctatctgtctgcttcatctgctgtccgcaacatgccaactcccttgcgcttcatggttgatgaagtggaccatggataatgtggttgagctggggtatgacacacacaaaattctggaacatctcatgcatgctgcatgtgtaaccactcaatgctgaggtttctgtctaagtcaactagggttttatcacttgttttcttaaatgggcacaacacaaaaaagaaaacttttataatatttagtgctagcacatctcaaagaccgaacaattactcttctatattgatttccttatcagttatcattgatatacttttttcatctgtgagtttttttgtttacattatattgttcatgctctaaacatagaagttgtgtagtaacatctaggaaaaattatacgatactgttgcctgctgagccttcctcttaatacaactctctatttgtttattttgtagatgtgggagaagtttgagcaagttggccaagagatgacaggtctagcgagcaacctttcaaccatttcacgagtttcataccaaaagcaggtaatctgttgctttatctttcaattaatgtctctagcgtcgagatggttatattttgacaatttgagttaagataaatctattactgcacacttggcaaccatgctgcaatttgcaggatgctttagtatattgaaatctttccttttatgctgggcattactaatggataaattattttataggcttctggattttctgaagctgaggtggctgagcacagaatagaggtaagttgtctgtttgaggatgtttgctaatcattgttccacatgcacacttaattaataatggttttactaattgcattcttcattaggaaataagtttgccgggtgctgtccacgttgtcacaaaggagtcgactaccaccgtgcagttggccccatgtgattctagtcattctacaataccgaaacgaactgtgccacctggacgtgatctgtgcccttgcgatggttgtggcaccaaggtagatgttgaagaaggcctaatctgtgatgaatgtgacaccatgtaccactttgcatgtgtcaagctactcaatcctgatattaagcaagtcccagcaatctggcattgttcaacctgcagcttcaagaaaaaagaattggctgcagataccacgaataatgttgcccatgactgcttgcatggtggtaactgtgttttgtgtgaccagctcgagctggtgaagacagaagaagaagatcccaagcttcccataaaaattgaattagctgaagaaagagaggggagctccgtctcaagcatgggggaagacaatgaaccagacctgtcaacaactgccctgtcaaacttgtgcaaacactgtggcacatgcgaagacgatgacaagagattcatggtatgcggacatccttactgcgtttacaagttctatcatatccgatgcctgaaaacaagccagcttgcaattgagcaacaaaagaagcttggttgctggtactgcccctcttgcctctgcagagggtgcttccaagacaaggatgatgaccagatagtcatgtgtgatggctgtgatgaaggttatcacatatattgcatgagaccagcacgcaacactatccccaaaggtaagtggtactgtacattttgcaagatccgcagggcagcggaaggaatgcataagtatgaggattctgtgctgaaaatacatgggaatagtaagcatgcttgtaatgtgaatcagtcgaaggattctgaaggtgatggtactgaaaagtgatcatcacaatagctttgtggattagcttctgagctcgcttggacaagctcaggaaaagagattctttggccccttaggagggctatacaccgactttgatactgaatcagttgtgtagtttatttaattaactgccgttgacatctacaggaagaactcttacctggtgaagatggtgtatgtagtcttttagctgggcggaatgatgtgttgtttacttgttcaccttccttctttaccccctttcagtgaccattgtgaatgttgtcctgtacttgccctgtgatggtattcttaaacgtttttttgggggaaatatgattttgtttttttaatctcctttttattgcttgattcgtcattgtttatagcctgtgatcgatgattgtgaaggtttatagtctgtatgttgtgtatgtaatggtttggttgatcctgaagctttttggaggtcttatttcagtcgaggacaagcatgagagtcaaggaagaaagtggatcttcattttgtcagacaattgtgacagtcatggagcatgtaagtagtactagtatatagtttgagtgtatgactaaccctgaatattcattcctatagtaaatagtactcctatatcatattagagattctgtggttggattaataagtagtgtagctatatctccagatgatgaatttatatgtgtccttgatatgaattaatgatatttgtggtgagtgttgacctc</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0105000, RefSeq:Os08g0105000