Os06g0594600

From RiceWiki
Revision as of 14:09, 8 June 2014 by Xiaoyanjie2012 (talk | contribs) (1.The Mitchell Clade of BAHD Acyltransferases Is Expanded and Diverged in Grasses)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

OsAt10 is a gene in rice(Oryza sativa).Its RAP ID is Os06g0594600,and its MSU ID LOC_Os06g39390. Overexpression of this gene can alters rice cell wall hydroxycinnamic acid Content and saccharification.

Function

The overexpression of the rice gene -- OsAt10(LOC_Os06g39390) -- can effect the hydroxycinnamic acid content and saccharification in the rice cell wall.rice mutants with altered expression of four of these genes have altered cell wall hydroxycinnamate content. In-depth characterization of ectopic expression lines for one gene, OsAt10, revealed that this modification increases matrix polysaccharideassociated ester-linkedp-CA while simultaneously decreasing matrix polysaccharide-associated FA.OsAt10 overexpression plants exhibit increased in vitro saccharification, with no discernible effects on vegetative development. Thus, this gene is a useful target for improving biofuel and feed production. Grass cell wall properties influence food, feed, and biofuel feedstock usage efficiency. The glucuronoarabinoxylan of grass cell walls is esterified with the phenylpropanoid-derived hydroxycinnamic acids ferulic acid (FA) and para-coumaric acid (p-CA). Feruloyl esters undergo oxidative coupling with neighboring phenylpropanoids on glucuronoarabinoxylan and lignin. Examination of rice (Oryza sativa) mutants in a grass-expanded and -diverged clade of BAHD acyl coenzyme A-utilizing transferases identified four mutants with altered cell wall FA or p-CA contents.Some researchers reported on the effects of overexpressing one of these genes, OsAt10 (LOC_Os06g39390), in rice. An activation-tagged line, OsAT10-D1, shows a 60% reduction in matrix polysaccharide-bound FA and an approximately 300% increase in p-CA in young leaf tissue but no discernible phenotypic alterations in vegetative development, lignin content, or lignin composition. Two additional independent OsAt10 overexpression lines show similar changes in FA and p-CA content. Cell wall fractionation and liquid chromatography-mass spectrometry experiments isolate the cell wall alterations in the mutant to ester conjugates of a five-carbon sugar with p-CA and FA. These results suggest that OsAT10 is a p-coumaroyl coenzyme A transferase involved in glucuronoarabinoxylan modification. Biomass from OsAT10-D1 exhibits a 20% to 40% increase in saccharification yield depending on the assay. Thus, OsAt10 is an attractive target for improving grass cell wall quality for fuel and animal feed.[1]

1.The Mitchell Clade of BAHD Acyltransferases Is Expanded and Diverged in Grasses

Mitchell et al. (2007) identified what we term the Mitchell clade of BAHD acyl-CoA-dependent acyltransferases on the basis of high gene expression in grasses relative to dicots. To refine the hypothesis that these enzymes might be involved in grass-diverged cell wall synthesis, we systematically characterized the distribution of this clade in selected plant species and compared the clade with other characterized BAHD proteins. We identified BAHD proteins from the genomes of a diverse set of sequenced plant species available at the time of the analysis and examined the phylogenetic relationships among them and a reference set of BAHDs (Table I). To gain higher sensitivity relative to local sequence alignment (i.e. BLAST) for recognizing sequences with low, but potentially still significant, homology, we used a hidden Markov model to identify putative BAHD proteins (Finn et al., 2011) The researchers then inferred an initial model of the phylo-genetic relationships among the putative BAHD proteins from each genome and the set of biochemically characterized BAHD proteins cataloged by D’Auria (2006). While we are aware that recent analyses have included the presence of a strict HXXXD motif as indicative of whether the protein is an active BAHD (Banks et al., 2011; Tuominen et al., 2011), we have included proteins with single amino acid alterations to this motif, since one of the known biochemically active proteins for the family involved in taxol biosynthesis, BAPT (National Center for Biotechnology Information identifier AAL92459; Walker et al., 2002), possesses a variation of this motif in which the His is replaced by a Ser. As observed by Tuominen et al. (2011), the distribution of BAHD proteins varies among species (Table I). The Mitchell clade is embedded within clade V, or clade Va of Tuominen et al. (2011). Furthermore, we find that the Mitchell clade includes a biochemically characterized banana (Musa spp.) alcohol CoA acyltransferase, BanAAT (Beekwilder et al., 2004), and is related to a group of BAHD proteins that participate in taxol biosynthesis (Fig. 1B).

Table 1xxy.pngFigure 1xxy.png

2.Screen of Rice Mutants for Altered Cell Wall Hydroxycinnamic Acid Content

Data are for homozygous wild-type segregant plants (gray bars) and homozygous mutant plants (hatched bars). Each plant line is designated by the repository identifier and the putative target gene. A and D, Average FA content from an AIR preparation. B and E, p-CA content from AIR. C and F, The ratio of FA to p-CA. Side tillers from lines 1B-00523 and 2D-40243 were harvested 10 weeks after germination. All other lines were harvested 7 weeks after germination. Averages from samples from two to three plants for each genotype were measured independently. Error bars indicate SD . *Significant difference at P , 0.05,**significant difference at P , 0.01 (Student’s t test).

Figure 2xxy.png

Expression

For the remaining 11 lines, we characterized the alkali-labile hydroxycinnamoyl ester content of cell wall alcohol-insoluble residue (AIR) from leaf blades and sheaths of side tillers. We compared homozygous, mutant, and wild-type segregant plants 7 or 10 weeks after planting. The screen revealed four mutants with possible cell wall hydroxycinnamic acid phenotypes . All four lines showed changes in the expression of the nearest acyltransferase gene to the T-DNA insertion site via quantitative reverse transcription (qRT)-PCR. Homozygous mutant progeny of4A-03423(here afterreferred to asOsAT10-D1), which has increased expression of OsAt10, exhibited reduced FA (approximately 60% less) and an increase in p-CA (approximately 300% more) in sheaths and leaves.TheT-DNA insertions it efort helinewerefertoas OsAT10-D1(PFG_4A-03423) is approximately 8.5 kb downstream of the transcriptional start site forOsAt10. The insert is oriented with the activating sequences proximate toOsAt10and in the range observed to activate expression (Jeong et al., 2006). As mentioned above, qRT-PCR indicated that, indeed,the expression ofOsAt10was increased by more than 100-fold in the leaves of homozygous OsAT10-D1 plants (Fig. 3B). InOsAT10-D1, besides OsAt10the expression of other genes proximate to the site of the T-DNA insertion does not vary significantly relative to the wild type (Fig. 3B). Similarly, the expression of related OsAtgenesdoesnotvarysignificantly in OsAT10-D1(Supplemental Fig. S2), reducing the possibility that the observed phenotype is due to compensation at the level of gene expression of a related acyltransferase. Of the acyltransferase transcripts examined in this survey, OsAt6appears to vary the most, although not significantly. However, OsAt6(LOC_Os01g08380) is expressed near the lower limitofourdetectionand,infact,wasreportedas undetectable in a previous qRT-PCR study (Piston et al., 2010). OsAT10-D1lines show no change in size and dry mass at maturity (Fig. 4, A and B). However, we did measure an approximately 20% to 30% decrease in total seed mass per plant for the mutant compared with the wild type.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1. Bartley, L.E., et al., Overexpression of a BAHD acyltransferase, OsAt10, alters rice cell wall hydroxycinnamic acid content and saccharification. Plant physiology, 2013. 161(4): p. 1615-1633.

Structured Information

Gene Name

Os06g0594600

Description

The start codon is not identified.

Version

NM_001064516.2 GI:297606110 GeneID:4341427

Length

1126 bp

Definition

Oryza sativa Japonica Group Os06g0594600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:24256206..24257331

Sequence Coding Region

24256486..24257331

Expression

GEO Profiles:Os06g0594600

Genome Context

<gbrowseImage1> name=NC_008399:24256206..24257331 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:24256206..24257331 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gatttgcaggtgacgacgttcacctgcggcggcttcgtgatcgggctgcgcaccaaccacgcggtggcggacggcaccggcgccgcccagttcatgaacgccgtcggcgacctcgcccgcggcctcccggagccgcgggtgaagccgatctgggcgcgcgaccgcttcccggacccggacatcaagcccggcccgctgccggagctccccgtgctgccgctccagtacatcgccttcgacttccccgccgcctacctcggcaagctcaaggcgcagtacgccgccaccgccggcgccagcaagatctgctccgccttcgacatcgtcatcgccaagctctggcagtgccggacgcgcgccatcgccgccgaccccgccgcggccgtcaagctctgcttcttcgccagcgcccgccaggtgctcggcctggagaccggctactggggcaacgccatcttcccggtgaaggtgtccgcggcggcgggggaggtggcggcgtcgtcggtgatcgagctcgtcggcgtggtccgggaggcgaagcggcggatggccggcgagtgcctgcgctgggcggaggggcgcaccggcggcgccgacccgttccagatgacgttcgactacgagtccgtgtacgtgtcggactggagcaagctcgggttcaacgacgtcgactacgggtacggcgcgccgtcggcggcggggccgctggtgaactgcgacctcatctcgtcggtgatcgtcatgcgggcgccggcgccgctcgccggcacgcggctgctggcgagctgcgtcaccaaggagcacgccgacgacttcgccgccaggatgagggaggatctcgtctaa</cdnaseq>

Protein Sequence

<aaseq>DLQVTTFTCGGFVIGLRTNHAVADGTGAAQFMNAVGDLARGLPE PRVKPIWARDRFPDPDIKPGPLPELPVLPLQYIAFDFPAAYLGKLKAQYAATAGASKI CSAFDIVIAKLWQCRTRAIAADPAAAVKLCFFASARQVLGLETGYWGNAIFPVKVSAA AGEVAASSVIELVGVVREAKRRMAGECLRWAEGRTGGADPFQMTFDYESVYVSDWSKL GFNDVDYGYGAPSAAGPLVNCDLISSVIVMRAPAPLAGTRLLASCVTKEHADDFAARM REDLV</aaseq>

Gene Sequence

<dnaseqindica>1..846#gatttgcaggtgacgacgttcacctgcggcggcttcgtgatcgggctgcgcaccaaccacgcggtggcggacggcaccggcgccgcccagttcatgaacgccgtcggcgacctcgcccgcggcctcccggagccgcgggtgaagccgatctgggcgcgcgaccgcttcccggacccggacatcaagcccggcccgctgccggagctccccgtgctgccgctccagtacatcgccttcgacttccccgccgcctacctcggcaagctcaaggcgcagtacgccgccaccgccggcgccagcaagatctgctccgccttcgacatcgtcatcgccaagctctggcagtgccggacgcgcgccatcgccgccgaccccgccgcggccgtcaagctctgcttcttcgccagcgcccgccaggtgctcggcctggagaccggctactggggcaacgccatcttcccggtgaaggtgtccgcggcggcgggggaggtggcggcgtcgtcggtgatcgagctcgtcggcgtggtccgggaggcgaagcggcggatggccggcgagtgcctgcgctgggcggaggggcgcaccggcggcgccgacccgttccagatgacgttcgactacgagtccgtgtacgtgtcggactggagcaagctcgggttcaacgacgtcgactacgggtacggcgcgccgtcggcggcggggccgctggtgaactgcgacctcatctcgtcggtgatcgtcatgcgggcgccggcgccgctcgccggcacgcggctgctggcgagctgcgtcaccaaggagcacgccgacgacttcgccgccaggatgagggaggatctcgtctaatataccatggccgcccccaataacattattagtcacgtacaatattgtcactgaatattaatttgttcgtgtatatctattgtggtatgtattttttttttcataggaaaaaagtagtagtacgacaataggtagctgggagctacctaatatcgacctctggtttgagagtaagtgagcgagcgagagatgtaaaccacctcagtttttaccgtgctttgtgacatgcgtggtacagtactggtactattaatcattggccgtgaaaaattatctaccc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0594600, RefSeq:Os06g0594600

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1