Os01g0704100

From RiceWiki
Revision as of 11:20, 9 June 2014 by Lynne (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

 The gene name of High-affinity Nitrate Transporter is OsNRT2.3, it located on Chromosome 1.  

Function

  When the rice in a low nitrate supply environment , OsNRT2.3 plays an important role in nitrate and long distance transport from root to shoot.
  On the one hand, overexpression of OsNRT2.3 can not only improve the total dry matter's accumulation and translocation in the later stage, but also can significantly increase dry matter's translocation efficiency and contribution rate of transferred dry matter in rice. On the other hand, overexpression of OsNRT2.3 can not only increase the amount of nitrogen accumulation and nitrogen translocation amount, but also can significantly increase rice N translocation rate and nitrogen contribution rate in the later stage.
  OsNRT2.3 gene silencing could inhibit N03- transport to the shoot from underground, which leads to the accumulation of NO3- in rice roots, and thus indirectly down regulated OsNRT2.1/2.2 expression, eventually lead to reduced nitrate uptake in rice roots from the environment.

Expression

  In the field growth conditions, OsNRT2.3 mainly express in the root, it also express in the leaf and other parts in a low expression level. In the whole growing period, the amount of OsNRT2.3 expression in leaves increased with the growth of the plant, it reaches a maximum value in the vegetative growth to reproductive growth transition stage , then decrease to a relatively stable range. Rice protoplast subcellular localization experiments showed that OsNRT2.3 is transmembrane protein of plasma membrane localization, this is consistent with bioinformatics prediction results.
  OsNRT2.3aWas Localized to the Plasma Membrane
  To determine subcellular location, OsNRT2.3a was fused in frame with GFP and transiently expressed in rice protoplasts under the control of the cauliflower mosaic virus 35S promoter. Analyses ofOsNRT2.3a -GFP-expressing rice protoplast cells by confocal micros-copy showed that the green fluorescence was confined to the plasma membrane. Thus, OsNRT2.3a is a plasma membrane-localized nitrate transporter.
  OsNRT2.3aWas Mainly Expressed in Root Stelar Cells

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory of Crop Genetics and Ge rmplas m E nhancement a nd Ke y Laboratory of Plant Nutrition and F erti lization in L ow -Mid dle R each es of th e Yan gtze River, Ministry of Agriculture, Nanjing Agricultural University, N anjing 210095, China ; Disease a nd Stress Biology Department, J ohn Innes Center, N orwich NR4 7UH, U ni te d Kingdom

References

 1、Zhong Tang;Xiaorong Fan;Qing Li;Huimin Feng;Anthony J. Miller;Qirong Shen;Guohua Xu
 Knockdown of a Rice Stelar Nitrate Transporter Alters Long-Distance Translocation But Not Root Influx
 Plant Physiology, 2012, 160(4): 2052-2063
 2、The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan. PMID 18089549
 3、Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb. PMID 17210932
 4、The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971
 5、The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11. PMID 16100779

Structured Information

Gene Name

Os01g0704100

Description

Similar to Membrane transporter

Version

NM_001050538.1 GI:115439446 GeneID:4324249

Length

2087 bp

Definition

Oryza sativa Japonica Group Os01g0704100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:30944695..30946781

Sequence Coding Region

30944917..30945104,30945195..30946467

Expression

GEO Profiles:Os01g0704100

Genome Context

<gbrowseImage1> name=NC_008394:30944695..30946781 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:30944695..30946781 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggctaagccggtggcgatggaggtggagggggtcgaggcggcggggggcaagccgcggttcaggatgccggtggactccgacctcaaggcgacggagttctggctcttctccttcgcgaggccacacatggcctccttccacatggcgtggttctccttcttctgctgcttcgtgtccacgttcgccgtgttcgcgcgtctggccatgggcacggcgtgcgacctggtcgggcccaggctggcctccgcgtctctgatcctcctcaccacaccggcggtgtactgctcctccatcatccagtccccgtcggggtacctcctcgtgcgcttcttcacgggcatctcgctggcgtcgttcgtgtcggcgcagttctggatgagctccatgttctcggcccccaaagtggggctggccaacggcgtggccggcggctggggcaacctcggcggcggcgccgtccagctgctcatgccgctcgtgtacgaggccatccacaagatcggtagcacgccgttcacggcgtggcgcatcgccttcttcatcccgggcctgatgcagacgttctcggccatcgccgtgctggcgttcgggcaggacatgcccggcggcaactacgggaagctccacaagactggcgacatgcacaaggacagcttcggcaacgtgctgcgccacgccctcaccaactaccgcggctggatcctggcgctcacctacggctacagcttcggcgtcgagctcaccatcgacaacgtcgtgcaccagtacttctacgaccgcttcgacgtcaacctccagaccgccgggctcatcgccgccagcttcgggatggccaacatcatctcccgccccggcggcgggctactctccgactggctctccagccggtacggcatgcgcggcaggctgtgggggctgtggactgtgcagaccatcggcggcgtcctctgcgtggtgctcggaatcgtcgacttctccttcgccgcgtccgtcgccgtgatggtgctcttctccttcttcgtccaggccgcgtgcgggctcaccttcggcatcgtgccgttcgtgtcgcggaggtcgctggggctcatctccgggatgaccggcggcgggggcaacgtgggcgccgtgctgacgcagtacatcttcttccacggcacaaagtacaagacggagaccgggatcaagtacatggggctcatgatcatcgcgtgcacgctgcccgtcatgctcatctacttcccgcagtggggcggcatgctcgtaggcccgaggaagggggccacggcggaggagtactacagccgggagtggtcggatcacgagcgcgagaagggtttcaacgcggccagcgtgcggttcgcggagaacagcgtgcgcgagggcgggaggtcgtcggcgaatggcggacagcccaggcacaccgtccccgtcgacgcgtcgccggccggggtgtga</cdnaseq>

Protein Sequence

<aaseq>MEAKPVAMEVEGVEAAGGKPRFRMPVDSDLKATEFWLFSFARPH MASFHMAWFSFFCCFVSTFAVFARLAMGTACDLVGPRLASASLILLTTPAVYCSSIIQ SPSGYLLVRFFTGISLASFVSAQFWMSSMFSAPKVGLANGVAGGWGNLGGGAVQLLMP LVYEAIHKIGSTPFTAWRIAFFIPGLMQTFSAIAVLAFGQDMPGGNYGKLHKTGDMHK DSFGNVLRHALTNYRGWILALTYGYSFGVELTIDNVVHQYFYDRFDVNLQTAGLIAAS FGMANIISRPGGGLLSDWLSSRYGMRGRLWGLWTVQTIGGVLCVVLGIVDFSFAASVA VMVLFSFFVQAACGLTFGIVPFVSRRSLGLISGMTGGGGNVGAVLTQYIFFHGTKYKT ETGIKYMGLMIIACTLPVMLIYFPQWGGMLVGPRKGATAEEYYSREWSDHEREKGFNA ASVRFAENSVREGGRSSANGGQPRHTVPVDASPAGV</aaseq>

Gene Sequence

<dnaseqindica>223..410#501..1773#agcgccggcctcccaccggtcgcgtaagatcacgcccgaaatctttattcattttctctccaccggttgccctctcgccgcacccaaccatcgcgccacgccgcgccgcgctgccggagccgcgctttccgctatgctataagagctgacgcgcagggcacagcggatgtacgtacacacagtcactagctaagctgctagccttgctaccacgtgttggagatggaggctaagccggtggcgatggaggtggagggggtcgaggcggcggggggcaagccgcggttcaggatgccggtggactccgacctcaaggcgacggagttctggctcttctccttcgcgaggccacacatggcctccttccacatggcgtggttctccttcttctgctgcttcgtgtccacgttcgccgcgccgccgctgctgccgctcatccgcgacaccctcgggctcacggccacggacatcggcaacgccgggatcgcgtccgtgtcgggcgccgtgttcgcgcgtctggccatgggcacggcgtgcgacctggtcgggcccaggctggcctccgcgtctctgatcctcctcaccacaccggcggtgtactgctcctccatcatccagtccccgtcggggtacctcctcgtgcgcttcttcacgggcatctcgctggcgtcgttcgtgtcggcgcagttctggatgagctccatgttctcggcccccaaagtggggctggccaacggcgtggccggcggctggggcaacctcggcggcggcgccgtccagctgctcatgccgctcgtgtacgaggccatccacaagatcggtagcacgccgttcacggcgtggcgcatcgccttcttcatcccgggcctgatgcagacgttctcggccatcgccgtgctggcgttcgggcaggacatgcccggcggcaactacgggaagctccacaagactggcgacatgcacaaggacagcttcggcaacgtgctgcgccacgccctcaccaactaccgcggctggatcctggcgctcacctacggctacagcttcggcgtcgagctcaccatcgacaacgtcgtgcaccagtacttctacgaccgcttcgacgtcaacctccagaccgccgggctcatcgccgccagcttcgggatggccaacatcatctcccgccccggcggcgggctactctccgactggctctccagccggtacggcatgcgcggcaggctgtgggggctgtggactgtgcagaccatcggcggcgtcctctgcgtggtgctcggaatcgtcgacttctccttcgccgcgtccgtcgccgtgatggtgctcttctccttcttcgtccaggccgcgtgcgggctcaccttcggcatcgtgccgttcgtgtcgcggaggtcgctggggctcatctccgggatgaccggcggcgggggcaacgtgggcgccgtgctgacgcagtacatcttcttccacggcacaaagtacaagacggagaccgggatcaagtacatggggctcatgatcatcgcgtgcacgctgcccgtcatgctcatctacttcccgcagtggggcggcatgctcgtaggcccgaggaagggggccacggcggaggagtactacagccgggagtggtcggatcacgagcgcgagaagggtttcaacgcggccagcgtgcggttcgcggagaacagcgtgcgcgagggcgggaggtcgtcggcgaatggcggacagcccaggcacaccgtccccgtcgacgcgtcgccggccggggtgtgaagaatgccacggacaataaggtcgcggttgtagtacaactgtacaaattgatggtacgtgtcgtttgaccgcgcgcgcgcacagtgtgggtcgtggcctcgtgggcttagtggagtacagtgaggggtgtacgtgtgtcgtggcgcgcgcggtcacctcggtggccttgggattgggggggcactatacgctagtactccagatatatacgggtttgatttacttctgtggatcggcgcttgttggtggtttgctccctgtggtttttgtgatggtaatcatactcatactcaaacagtcaaaactttttgatg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0704100, RefSeq:Os01g0704100