Os05g0543000

From RiceWiki
Revision as of 11:53, 9 June 2014 by Meso12 (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

“Pectins are fundamental polysaccharides in the plant primary cell wall. ”[1] “OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. Germination of pollen and pollen tube elongation are significant processes in plant sexual reproduction. The apical cell wall of the pollen tube is exclusively made up of pectin. Pectins are synthesized and methylesterified in the Golgi and are later released in the apoplastic space. Further these methylesterified pectin polymers are demethylesterified by a class of enzymes named as pectin methyl esterases (PMEs). PMEs are ubiquitous enzymes and play an important role in pollen tube growth. In plants, the activity of PME is regulated either by differential expression or by PME inhibitor proteins (PMEI) (Micheli 2001). PMEI inhibit the activity of PME of plant origin and have a role in regulating cell wall stability at the tip of pollen tube (Di Matteo et al. 2005).”[2]OSIPP3 gene (coding for pectin methylesterase inhibitor protein) was isolated from a pre-pollinated inflorescence-specific cDNA library by differential screening of stage-specific libraries from Oryzasativa. OSIPP3is present in the genome of rice as a single copy gene. OSIPP3 gene was expressed exclusively in the pre-pollinated spikelets of rice.

File:Fig.111.jpg===Expression=== OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. 5‘-upstream regulatory region (URR; Khurana et al. 2012b) of OSIPP3 has been dissected by analyzing transgenic Arabidopsis plants harboring four deletions of upstream regulatory fragment (URF; will be used henceforth for denoting various deleted regions of OSIPP3 URR) for determining cis-regulatory elements involved in gene regulation. Four deletions of URR of OSIPP3 were transcriptionally fused to GUS reporter gene and transformed in Arabidopsis. OSIPP3_del1 and del2 transgenic plants showed blue color corresponding to GUS expression in root,anther and silique. Plants harboring OSIPP3_del3 construct showed GUS activity only in anthers and silique, while, pollen-specific expression was observed in case of OSIPP3_del4 transgenics.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

[1]Maojun Wang, Daojun Yuan mail, Wenhui Gao, Yang Li, Jiafu Tan, Xianlong Zhang et al. A Comparative Genome Analysis of PME and PMEI Families Reveals the Evolution of Pectin Metabolism in Plant Cell Walls. PLOS ONE. AUG 12 2013. [2]Reema Khurana, Hitesh Kathuria, Arnab Mukhopadhyay, Sanjay Kapoor, Akhilesh K. Tyagi et al. A 286 bp upstream regulatory region of a rice anther-Specific gene, OSIPP3, confers pollen-specific expression in Arabidopsis. Biotechnol Lett (2013) 35:455–462

Structured Information

Gene Name

Os05g0543000

Description

Plant invertase/pectin methylesterase inhibitor domain containing protein

Version

NM_001062735.1 GI:115465200 GeneID:4339485

Length

1347 bp

Definition

Oryza sativa Japonica Group Os05g0543000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:27009633..27010979

Sequence Coding Region

27009778..27009975,27010401..27010823

Expression

GEO Profiles:Os05g0543000

Genome Context

<gbrowseImage1> name=NC_008398:27009633..27010979 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:27009633..27010979 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataa</cdnaseq>

Protein Sequence

<aaseq>MARFVIISVVVVAAFAAAAVVEARVGPIDVAPTNLITNPLGAII DNGRKITGAVVDECAWTCDHVAAGNKKMCNTLRKLPGVSSPKELLTAAVKLSMRKAKA ARARFEAAARAAEKGTPMESILDTCKEGYDSTVSALQEVQRCIDANDSKASLITKMSA ATTFTGDCGNAYEERELEPSLALKATKNNVNRVVTGALAIAAKLKL</aaseq>

Gene Sequence

<dnaseqindica>146..343#769..1191#agccatcaccaaaccttttagcttctcagccttttgcctctctttctactctctttcttggccgtctctcttatatccctcaatttaaccatcgagggcggccaaaaaaaagagagaaaggaagagcaaaataacacattacaccatggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggtgagtgacgacactattgtccatggaagcttattttgatcgctcgagagggtccctcgtatttatatgtcacttaaataattataaaaaaattaaaaaaattaagaagacgtgttaacctgtgatatatcaccccacaaacatacacgttcaaattcaacttctgtatctcgcaacgaaaaaaataaattaaaccaaatatagatgtttaatttgaacttggatatttgtgaagtgatatataacatgttaatacatcttctcgaattttttttaatttttttataactatttgagtgacatgtaaacaatgagggaatgatgttcctcgagggattaaaatccactcccgctccagaaatggtcagaaaattacttactgctcatgtcatggatgaacagtctgtctattgatgttgatgcaggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataattagccaactgatcatcaatcgatatgaatgattgatcaactataaaattacacctagctcatgcatgcgtccgcgcgttatgtgtgtacgcacgcatgcatatgtgtaagatcgatcaacagatcacagaagtggtggcgtatctcgcacttgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0543000, RefSeq:Os05g0543000