Os01g0869200

From RiceWiki
Revision as of 12:29, 9 June 2014 by Tuntun (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

  OsMGT1 is a transporter for Mg uptake in the roots and that up-regulation of this gene is required for conferring Al tolerance in rice by increasing Mg concentration in the cell.

Expression

1 Sequence Analysis of OsMGT1 in Rice

OsMGT1 (Os01g0869200) cloned from rice (cv Nipponbare) contains six exons and five introns (Supplemental Fig. S1A), encoding a peptide of 418 amino acids. Using the SOSUI program (http://bp.nuap.nagoya-u.ac.jp/sosui/), it has been predicted that OsMGT1 is a membrane protein with two transmembrane domains near the C terminus (Supplemental Fig. S1B). OsMGT1 showed the similarity ranging from 63% to 81% to Arabidopsis Mg transporter AtMGT family at the amino acid level. Like other Arabidopsis members, there is a conserved Gly-Met-Asn tripeptide motif at the end of the first transmembrane (domain.http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/bin/PP_199778_LW_f1.gif) Example1234567.jpg

2 Expression Pattern of OsMGT1

Real-time reverse transcription (RT)-PCR analysis revealed that OsMGT1 was expressed in both the shoots and roots at similar level in the absence of Al . However, in the presence of Al, the expression in the roots was up-regulated by 5 times, but that in the shoots was unaffected. Root spatial analysis showed that OsMGT1 was expressed in both the root tips (0–1 cm) and mature region (1–2 cm) and the expression in both regions were up-regulated by Al. However, in art1 (a mutant defective in the Al response C2H2-type zinc-finger transcription factor), the Al-induced expression was not observed , confirming that OsMGT1 expression was regulated by ART1.(http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/figure/fig2/)

3 Sub-cellular Localization of OsMGT1

The subcellular localization of OsMGT1 was investigated in rice protoplasts by transiently expressing OsMGT1 fused with GFP at both C terminal and N terminal under the control of 35S promoter. Either construct gave a signal at the plasma membrane , in contrast to GFP alone, which signal was observed in cytosol and nuclei.(http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3425201/figure/fig3/)

Evolution

Labs working on this gene

Institute of Plant Science and Resources, Okayama University, Kurashiki 710–0046, Japan (Z.C.C., N.Y., J.F.M.); and Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305–8602, Japan (R.M., Y.N.)

References

1. Zhi Chang Chen;Naoki Yamaji;Ritsuko Motoyama;Yoshiaki Nagamura;Jian Feng Ma

 Up-Regulation of a Magnesium Transporter Gene OsMGT1 Is Required for Conferring Aluminum Tolerance in Rice
 Plant Physiology, 2012, 159(4): 1624-1633

Structured Information

Gene Name

Os01g0869200

Description

Mg2+ transporter protein, CorA-like family protein

Version

NM_001051459.1 GI:115441288 GeneID:4324927

Length

3103 bp

Definition

Oryza sativa Japonica Group Os01g0869200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:39420080..39423182

Sequence Coding Region

39420113..39420466,39420663..39420842,39421291..39421419,39421524..39421672,39421833..39421971
,39422557..39422862

Expression

GEO Profiles:Os01g0869200

Genome Context

<gbrowseImage1> name=NC_008394:39420080..39423182 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:39420080..39423182 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcggagggcgcagccggtgtcggcggcggtggcgccggtgacggggaggaggaagggtgcggcggcgagccggaagtggatggtggtgccggcggtgggggaggagcggagggtggagtttgggaagcaccagatcatgaagatgacggggctccccgggcgcgacctccgggtgctcgacccggtcctctcctacccgtccaccatcctcggccgcgaccgcgccatcgtcgtcaggctccagggcgtcaaggccatcatcaccgccaccgaggtgctcgtccccgaccacgacgacgtcctcctcgcctccttcctcctcgacctccgctcccgcctctccctcccggatgcggcgcctagcacgaatccggcggcggctgatcgcgggaacgggacggagcagggcgatcaggggagcgtgccaggtctggcgatcagcggtgctggcaacgccaagatcccgccctttgagttcaaggtgctcgaggtctgcctcgagcacgcatgcaaagacttggaatctcagacacgctctctggagaaggaggcgtatccggccttggacaagctgggatcgaaggttagcacgctgaacctggatcacgtcaggaatctgaagagccgcatggttgatctctcagggcgcgtgcagaagattagggatgagctggagcacttgctggatgacgacatggacatgtccgagatgtacctgacgaggaagctgtcgttccaagggctcagcggatcgctgagcagagcggattcacacaagtacgcatctgttgatcatgacgacgatagggaggaggaagaccatgacgatgagacagagagtggccgtgaaagttctgtttatgttaagcctgatatagaagagttggaaatgcttctggaagcttactttgtgcagatcgatggaacgctgaataccctgtaccatatccgtgaatacgcggacgacacggaggattacatcaacataatgctggacgagaagcagaaccagctgctgcagatgggcgtgatgctgacgacggcgacggtggtggtcaccgcgggcatcgtggtggtgagcctgttcggcatgaacatccacatcgacctgatgaaagacccggagacccccgagatggtgaggatgtccaacatgcacttttgggagaccaccttcggcacggtcgccggctgcatcgccatatacctcctggcgatctacgctgggaggaagagcaagatcctgcagtga</cdnaseq>

Protein Sequence

<aaseq>MERRAQPVSAAVAPVTGRRKGAAASRKWMVVPAVGEERRVEFGK HQIMKMTGLPGRDLRVLDPVLSYPSTILGRDRAIVVRLQGVKAIITATEVLVPDHDDV LLASFLLDLRSRLSLPDAAPSTNPAAADRGNGTEQGDQGSVPGLAISGAGNAKIPPFE FKVLEVCLEHACKDLESQTRSLEKEAYPALDKLGSKVSTLNLDHVRNLKSRMVDLSGR VQKIRDELEHLLDDDMDMSEMYLTRKLSFQGLSGSLSRADSHKYASVDHDDDREEEDH DDETESGRESSVYVKPDIEELEMLLEAYFVQIDGTLNTLYHIREYADDTEDYINIMLD EKQNQLLQMGVMLTTATVVVTAGIVVVSLFGMNIHIDLMKDPETPEMVRMSNMHFWET TFGTVAGCIAIYLLAIYAGRKSKILQ</aaseq>

Gene Sequence

<dnaseqindica>34..387#584..763#1212..1340#1445..1593#1754..1892#2478..2783#agccgccaccggggtcaccaccatcgagctcgtatggagcggagggcgcagccggtgtcggcggcggtggcgccggtgacggggaggaggaagggtgcggcggcgagccggaagtggatggtggtgccggcggtgggggaggagcggagggtggagtttgggaagcaccagatcatgaagatgacggggctccccgggcgcgacctccgggtgctcgacccggtcctctcctacccgtccaccatcctcggccgcgaccgcgccatcgtcgtcaggctccagggcgtcaaggccatcatcaccgccaccgaggtgctcgtccccgaccacgacgacgtcctcctcgcctccttcctcctcgacctccgctcccgcctctccctcccggttggtacaccgtacaccatctctttttctcttctgttttctcatcatcaccacatccaggttcactctgttgcattggttgtactagcagattgcatctgcaaactgatatgacattgaactctggaatttgattctgttatcgtcgtcgtgattgactctactgaaactctgatgatgattattctgggtgaaggatgcggcgcctagcacgaatccggcggcggctgatcgcgggaacgggacggagcagggcgatcaggggagcgtgccaggtctggcgatcagcggtgctggcaacgccaagatcccgccctttgagttcaaggtgctcgaggtctgcctcgagcacgcatgcaaagacttggaatctcaggtatactgccagaaaatttgtctattgctgctgatgatgaatcaaaccaatggtagtatatattaagggggtgtttagatctagaggtataaagttttggcgtgtcatttcgggcattatatatggtgtcgtatagggtattcggatactaataaaaaaattaattacataatccatcattaaaccgcaaaacgaatttattaagcataattaatccatcattagcaaatgtttactatagcaccacattgtcaaatcatggagcaattaggcttaaaagattcgtctcgtaaattagtcgcaatctgtgcaattagttattttttaacctatattaaatacttcatacatgtattcaaacgttcgatgtgacagggtgaaaaattttgaggtgtgatctaaacagggcctaattcatgttcatctctgtctctgcaaatggtgtcagacacgctctctggagaaggaggcgtatccggccttggacaagctgggatcgaaggttagcacgctgaacctggatcacgtcaggaatctgaagagccgcatggttgatctctcagggcgcgtgcagaaggtacgcaagaacagtggactccgttcgcttgagtccgtttaagttgcagctgaaagcgatggcacctaagcattttggccacctgttcttggtctcgcatgcagattagggatgagctggagcacttgctggatgacgacatggacatgtccgagatgtacctgacgaggaagctgtcgttccaagggctcagcggatcgctgagcagagcggattcacacaagtacgcatctgttgatcatgacgacgataggtatgtcacctgaattttgttctttctggtttttggcaggatcgaaagactcgaagtaggagttgttacctgaattctttaaccggaaatggatgttgattgttgatagattgccgatccgtggcttttgttttaatctttcatttgcgcctgtattcagggaggaggaagaccatgacgatgagacagagagtggccgtgaaagttctgtttatgttaagcctgatatagaagagttggaaatgcttctggaagcttactttgtgcagatcgatggaacgctgaataccctgtaccatgtatgttcatcctcctcctttactaagggcttcatcttttgcctataataaatcagccattgccaaattttaatataaaagttaattttagagtttattttgggcacttttaacatagtttcttttttagcaatagcttttaaatcactaaaaacacgcatctaaaagtttcacctacaaactattttttggttgctttgttttatacattttttagttgctaataagctgttatggtttataatcagctctcggtcaactgatgaagttgaacattgccatgcttagattgttactgaaatggttgtcatgctaatatcaactgttttagtacaatttagtgatactgtccagtttggaagataaacatgcgatatttagcataacttctgtaaaagtctctgcagccaaaatctgacgaaatcttgttaatgtttgccattgaaatcgacactggttttatcaaacagttaaaatgtatagcctgcattgtcacgcacttgcatcgctcactactagcaaattccatgcattgcttgatgtttcattgcccccctgacatttgcctattgacatggaacaaagatccgtgaatacgcggacgacacggaggattacatcaacataatgctggacgagaagcagaaccagctgctgcagatgggcgtgatgctgacgacggcgacggtggtggtcaccgcgggcatcgtggtggtgagcctgttcggcatgaacatccacatcgacctgatgaaagacccggagacccccgagatggtgaggatgtccaacatgcacttttgggagaccaccttcggcacggtcgccggctgcatcgccatatacctcctggcgatctacgctgggaggaagagcaagatcctgcagtgatgcttcccaacagaggaagctaagcgtcaggttgcgagttctgcagcctggctgcgattttgctgggcagtggcgtagttgataggttgtgtatggatgtgatgcatttttgttgatttcgtatggtgtgggagcaataataatcgaacgatctctctccatttcctgctcttattagaagttagcacttagcactactatgttaaatttcggccaaaggaaccactatgttaaatttcggccaaaggaaccctttcagaaatgctcttgccacatttcgcattcgaagtaaatccaaaaaaggtaccagtaattctcat</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0869200, RefSeq:Os01g0869200