File:Phylogenetic analysis and subcellular localization of RL14 protein.png
Contents
Annotated Information
Function
RL14 (rolling leaf 14) regulates leaf rolling, which is found to encode a 2OG-Fe (II) oxygenase of unknown function. the RL14 gene affects water transport in leaves by affecting the composition of the secondary cell wall. This change in water transport results in water deficiency, which is the major reason for the abnormal shape of the bulliform cells. RL14 mutant plants displayed smaller stomatal complexes and decreased transpiration rates, as compared with the wild type. Defective development could be rescued functionally by the expression of wild-type RL14.
Expression
Histochemistry, as well as qRT-PCR analysis, showed that RL14 was highly transcribed in leaves, leaf sheaths and roots. It was also detected in stems and glumes, although its expression in these organs was not as intense as that in the mature leaves, leaf sheaths and roots (Figure 6b).
Expression of RL14 mRNA was detected in the sclerenchymal cell layer of underemerged leaves and sheaths. In the mature leaf, RL14 mRNA accumulated mainly in the mesophyll cells that surrounded the vasculature (Figure 6c).
Analysis of the expression pattern for the RL14 gene
Evolution
The RL14 gene was mapped first to an interval between the simple sequence repeat (SSR) markers RM3123 and RM1162 on the long arm of chromosome 10.
Finally, the RL14 locus was mapped to a 24.5-kb DNA region between the InDel marker SID2 and SSR marker SW24 on a single bacterial artificial chromosome, AC079874.
Four annotated candidate genes, which encoded a polyol transporter (Os10g40950.1), a 2OG-Fe (II) oxygenase family protein (Os10g40960.1), a flavonol synthase (Os10g40990.1) and a retrotransposon protein (Os10g41000), were located in the 24.5-kb DNA region.
RL14 was related most closely to members of the 2OG-Fe (II) oxygenase family from rice and sorghum (Figure 5b). Orthologous of RL14 was identified in other species, such as maize, Arabidopsis, Papaver somniferum, Vitis spp and Ricinus communis (Figure 5b).
Phylogenetic analysis and subcellular localization of RL14 protein
Structured Information
Coding Sequence
1 gatgtactga cagtagctct agctcagttt gagatgtgca aatagtataa caaaagcatt
61 acttatgcaa caaaaactac agctcatcaa ccatggagtg ccagatgaag tgattgcaaa
121 tctcaagaac gacttggttg agtttttcag tcagccactg gatgccaaga aggaatactc
181 acagctgccc aataaccttg aaggttatgg acaggccttc gttgtgtccg acaaccagaa
241 actagactgg gcagacatgc tataccttca agtctgtcct accgattcaa gggacttgag
301 attctggccc aattaccctg cctctttcag gcattccatt gatgcatact catcagagac
361 agaaaatatt ggactctgcc tgctgcaatt catggccaag gccgttggtg ttgagccgaa
421 gtcgttgtta agtgtatttg aagggcaagc taggggtttg aggatgaact actatccacc
481 gtgcttgaaa gctgacaagg tgttgggttt gtcaccgcac actgatccag gtggcttgac
541 actgcttctc caggtgaatg atgtacaggg cctgcagatc aacaaggatg gcaaatggtt
601 ctccgtgaat gctctgaatg gtgcactcat cgttaacatt ggcgacacac ttgagatcct
661 gagtaatgga aagttcagaa gtgttgagca cagggccgtg gtacatccaa gcagagagag
721 gatttcagcg gcactgttct actatccgtg ccaggatatg gtgatcagcc ctctgccgga
781 ctttgtgaaa gatggtaaag tgaaatacaa aacaataagc taccaggatt tgctgacaga
841 gtacttcaca gcagagcttg atggaaggaa ccggctaaag aaaatgaagc tggaaccgta
901 gccatcgacc atgatgcatg taacaatttt ataagaagaa cctgctttca ggttgtgtcc
961 tacttactgt atctgctatc tactctcttc atcctaaaat aaataaacat agtacatata
1021 tgatacatca tagtaccata aattagaaaa tgttacatcg tgtactatgt ttttttaaaa
1081 aatttgggat ataggaaata tatgtcgtga agaataatgt attcaggcat caagctttat
1141 gcataattag cttatgcctg taaactgcgt tgaacatgtt cagtttgatg aaacagacat
1201 ggaagtttgc ctctt
Protein Sequence
MNYYPPCLKADKVLGLSPHTDPGGLTLLLQVNDVQGLQINKDGK WFSVNALNGALIVNIGDTLEILSNGKFRSVEHRAVVHPSRERISAALFYYPCQDMVISPLPDFVKDGKVKYKTISYQDLLTEYFTAELDGRNRLKKMKLEP
Reference
Likui Fang;Fangming Zhao;Yunfei Cong;Xianchun Sang;Qing Du;Dezhong Wang;Yunfeng Li;Yinghua Ling;Zhenglin Yang;Guanghua He.Rolling-leaf14 is a 2OG-Fe (II) oxygenase family protein that modulates rice leaf rolling by affecting secondary cell wall formation in leaves
Plant Biotechnology Journal, 2012, 10(5): 524-532
Labs working on this gene
Rice Research Institute, Chongqing Key Laboratory of Application and Safety Control of Genetically Modified Crops, Southwest University, Chongqing, China.
File history
Click on a date/time to view the file as it appeared at that time.
| Date/Time | Thumbnail | Dimensions | User | Comment | |
|---|---|---|---|---|---|
| current | 12:38, 9 June 2014 | 518 × 445 (252 KB) | Zhangyn (talk | contribs) |
- You cannot overwrite this file.
File usage
The following 2 pages link to this file: