Os06g0157500

From RiceWiki
Revision as of 13:13, 9 June 2014 by Sunlight (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Fig.2 . RFT1 encodes LD florigen. (from reference[1]).

FLOWERING LOCUS T 1 (RFT1) is a florigen gene in rice (Figure 1), because an RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions (Figure 2). RFT1 is the closest homolog to Heading date 3a (Hd3a) and is a major floral activator under LD conditions..RFT1 and Hd3a regulate rice flowering under LD and SD conditions.OsMADS50, an LD floral activator, acts upstream of Ehd1 and RFT1.OsMADS14 and OsMADS15 act downstream of RFT1 in the SAM under LD conditions.Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice The OsMADS50-Ehd1-RFT1 pathway is involved in floral activation under LD conditions(Figure 2 )[1].

Fig.2. . A model for the photoperiodic control of flowering in rice. (from reference[1]).

Mutation

Polymorphisms in the promoter region that lead to reduced expression levels of RFT1. An amino acid substitution (E105K) that leads to a functional defect in Nona Bokra RFT1. The E105K mutation is found only in indica, and a strong association was founded between the RFT1 haplotype and extremely late flowering in a functional Hd1 background.. Furthermore, SNPs in the regulatory region of RFT1 and the E105K substitution in 1,397 accessions show strong linkage disequilibrium with a flowering time–associated SNP. [2] .

Expression

Developmental expression of RFT1 in the SAM under LD conditions through stages 1-5 (Figure 3 ) [1].

Evolution

The ratios of nonsynonymous to synonymous substitutions suggest that the E105K mutation resulting in the defect in RFT1 occurred relatively recently. These findings indicate that natural mutations in RFT1 provide flowering time divergence under long-day conditions [2] .

Labs working on this gene

  • Genetic Resources Center, National Institute of Agrobiological Sciences, Kannondai Tsukuba, Ibaraki, Japan[2] .
  • Institute of Crop Sciences, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, Japan[2] .
  • Iwate Agricultural Research Center, Narita, Kitakami, Iwate, Japan[2] .
  • National Institute of Genetics, 111-1 Yata, Mishima 411-8540,Japan [1].
  • Faculty of Agriculture, Iwate University, Morioka 020-8550, Japan [1].

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Reina Komiya*, Shuji Yokoi and Ko Shimamoto. A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice .Development 136, 3443-3450 (2009) doi:10.1242/dev.040170.
  2. 2.0 2.1 2.2 2.3 2.4 Ogiso-Tanaka E, Matsubara K, Yamamoto S-i, Nonoue Y, Wu J, et al. (2013) Natural Variation of the RICE FLOWERING LOCUS T 1 Contributes to Flowering Time Divergence in Rice. PLoS ONE 8(10): e75959. doi:10.1371/journal.pone.0075959

Structured Information

Gene Name

Os06g0157500

Description

Similar to CiFT protein

Version

NM_001063394.1 GI:115466519 GeneID:4340184

Length

1652 bp

Definition

Oryza sativa Japonica Group Os06g0157500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:2925824..2927475

Sequence Coding Region

2926081..2926284,2926432..2926493,2926607..2926647,2927174..2927403

Expression

GEO Profiles:Os06g0157500

Genome Context

<gbrowseImage1> name=NC_008399:2925824..2927475 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:2925824..2927475 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggcagcggcagggacgatcctcttgtggttggcaggattgtgggtgatgtgctggatccattcgtccggatcactaacctcagtgtcagctatggtgcaaggatcgtctccaatggctgcgagctcaagccgtccatggtgacccaacagcccagggtcgtggtcggtggcaatgacatgaggacgttctacacactcgtgatggtagacccggatgctccgagcccaagcaaccctaaccttagggagtatctacactggctggtcaccgatattcctggtaccactggagcaacatttgggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacggtgtacgcaccggggtggcgccagaacttcagcaccaggaacttcgccgagctctacaacctcggctcgccggtcgccaccgtctacttcaactgccagcgcgaggccggctccggcggcaggagggtctacccctag</cdnaseq>

Protein Sequence

<aaseq>MAGSGRDDPLVVGRIVGDVLDPFVRITNLSVSYGARIVSNGCEL KPSMVTQQPRVVVGGNDMRTFYTLVMVDPDAPSPSNPNLREYLHWLVTDIPGTTGATF GQEVMCYESPRPTMGIHRLVFVLFQQLGRQTVYAPGWRQNFSTRNFAELYNLGSPVAT VYFNCQREAGSGGRRVYP</aaseq>

Gene Sequence

<dnaseqindica>258..461#609..670#784..824#1351..1580#cctgtcactgtttggctagcttaaccttcctgacatctatcctctggattgaacggcaggagatacctaagctagctagcaatctctatcgatctgtttgtttacatgttcagttaaaggttactgagaaatgcctagagtttttccggctagcttcataagttagtgggttagctgacctagattcaaagtctaatccttttatttatttgatattagatatcctaacgtttttagttagaggttattaatttgacatggccggcagcggcagggacgatcctcttgtggttggcaggattgtgggtgatgtgctggatccattcgtccggatcactaacctcagtgtcagctatggtgcaaggatcgtctccaatggctgcgagctcaagccgtccatggtgacccaacagcccagggtcgtggtcggtggcaatgacatgaggacgttctacacactcgtacggatcatatcttggatgcagagacccaccagaagttatttaattactttcattaattatcataaaactagactataaattatattttttacatggatgcatgttaattttgtgtggcttacgtactaatctaattacctacaggtgatggtagacccggatgctccgagcccaagcaaccctaaccttagggagtatctacactggtaggcaccgatcagatatgttagctagctaattgtatacattcgtcctagaatataaagaatttggaccggattctcaatcattcgcgttgattctctttgtctgtctgtaggctggtcaccgatattcctggtaccactggagcaacatttggtcagtaaactagtatatatatatagtactcatatcaatttcgatgtaacagcaacatatgtggcagttccatgaatttttattaccttggtcctaccccatatatatacttcaaaaattgcataatgacaaaattatactccctccgtattttaatgtatgacgccgttgactttttaaccaacatttgaccattcgtcttatttaaattttttatgcaaatacaaaaatacttatgtcatgcttaaagaacatttgatgataaatcaagtcacaataaaataaatgataattacataatttttttgaataagacaaaaagtcaaacgtttgttaaaaagtcaatgtcgtcatacattaaaatacggagggagtatctattttgtcaaaaattttcgtcagatttgaaggatagggctgtacttcttctatgccaaaatggagggtggtgatcccctcaaaacttgtagaacagccactgttgatatatatatggtgaataacgtagataattaaattgatgcagggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacggtgtacgcaccggggtggcgccagaacttcagcaccaggaacttcgccgagctctacaacctcggctcgccggtcgccaccgtctacttcaactgccagcgcgaggccggctccggcggcaggagggtctacccctagctagctacgcatgccacccggcctccatgcatgcagcagctatagctaagctgagacctgcctagctgtata</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0157500, RefSeq:Os06g0157500