Os04g0602600

From RiceWiki
Revision as of 14:28, 9 June 2014 by Huanghs (talk | contribs) (Others about the gene)
Jump to: navigation, search

The rice gene Os04g0602600,namely MPR25,is a pentatricopeptide repeats protein and encodes a pentatricopeptide repeat protein and is essential for RNA editing of nad5 transcripts in mitochondria. [1]

Annotated Information

Function

  • The mpr25 mutant exhibits a mild phenotype of pale-green leaves and growth retardation

MPR25 encodes an 805 amino acid protein with 16 PPR motifs and an E domain at its C-terminus, based on Pfam motif analysis (http://pfam.sanger.ac.uk./search?tab=search SequenceBlock) (Figure 1a). These 16 PPR motifs are grouped into five canonical PPR motifs (P motif), six PPRlike S motifs (short) and five PPR-like L motifs (long) [2] In the Tos17 insertion line NC0057, Tos17 was inserted at nucleotide 1327 from the initiation codon in the ninth PPR motif of MPR25 (Figure 1a). Quantitative RT-PCR analysis of MPR25 mRNA showed that MPR25 was highly expressed in green leaves of a wild-type (WT) plant (Figure 1b) and weakly so in leaves of etiolated seedlings, roots, pollen, pistils, seeds and calli. In contrast, the amount of mRNA in the green leaves of the mutant was <5% of that in the WT (Figure 1c). Due to the disruption in the ninth PPR motif and reduced mRNA levels, we considered the mutant allele to be a null allele. The segregation of +/) (hemizygously carrying the Tos17 inserted allele) self-fertilizing progeny was 129 +/+: 217 +/): 99 )/) (equivalent to 1:2:1, v2 = 4.32, 0.1<P<0.2), indicating that no haploid lethality or seed abortion phenotypes were caused by the mpr25 mutation. The homozygous mpr25 mutant exhibited growth retardation (Figure 1d). The maximum shoot length of 1-week-old seedlings of the homozygous mpr25 plants under natural light conditions was indistinguishable from that of the WT; however, shoots of 2–11-week-old seedlings homozygous for mpr25 were significantly shorter than those of WT (Figure 2a). Growth retardation was also observed when the plants were grown in the dark (Figure S1). The maximum shoot length of the mpr25 mutant was significantly shorter than that of WT in 2- and 3-week-old etiolated seedlings grown in the dark (Figure 2b). Under natural light conditions, the mutant exhibited palegreen leaves (Figure 1d). The decreased intensity of green color was confirmed by the reduction of chlorophyll content (SPAD value), which was determined using a chlorophyll meter. The SPAD values of the mutant were significantly lower than those of WT in 2–5-week-old seedlings (Figure 2c). These results indicate that the mpr25 mutant is deficient in chlorophyll content. Although the mpr25 mutant showed shorter shoot length and lower chlorophyll content until 11 weeks after germination, these deficiencies recovered to the normal state after 13 weeks (Figure 2a,c). After the flowering stage at 16 weeks, the maximum shoot length and SPAD value were almost identical in the mpr25 mutant and WT. The maximum shoot length was 97.3 _ 0.7 cm in the mpr25 mutant and 101.3 _ 0.7 cm in the WT at 16 weeks. The SPAD value was 41.7 _ 0.2 in the WT and 34.8 _ 2.1 in the mpr25 mutant. Although these parameters recovered in the mutant at the flowering stages, the number of tillers remained suppressed (Figure 2d), with 1–3 being present in the mpr25 mutant compared with 12 in the WT at 16 weeks after germination (Figure 2d). Reduced tiller branching was probably caused by the initial growth retardation. The flowering stage was retarded by 2 weeks in the mpr25 mutant. A 2415 bp DNA fragment corresponding to the full-length MPR25 open reading frame (ORF) under the control of the ubiquitin promoter (Ubi-MPR25) was introduced into the mpr25 mutant for the complementation test. All 10 transgenic plants expressing Ubi-MPR25 recovered normal development, in contrast to six transgenic plants expressing Ubi-GUS, which did not show any complementation of the mutant phenotype (Figure 1d). The complemented phenotype was stably inherited in the T1 plants. In the T1 generation, the maximum shoot length of 8-week-old plants was 24.1 _ 3.9 cm in the mpr25 plants transformed with Ubi-GUS and 44.7 _ 0.7 cm in the transgenic plants complemented with Ubi-MPR25, compared with 45.1 _ 1.0 cm in WT. The SPAD value was 38.0 _ 1.5 in WT, 22.4 _ 0.5 in the mpr25 plants expressing Ubi-GUS, and 37.3 _ 0.7 in the complemented mpr25 plants expressing Ubi-MPR25. These results confirm that the mutant phenotype of reduced shoot length and low chlorophyll content is caused by disruption of MPR25.

  • MPR25 protein is targeted to mitochondria

Green fluorescent protein (GFP) was fused to the C-terminus of MPR25, and the fusion protein was transiently expressed in epidermal cells of Tulipa gesneriana leaves by particle bombardment assay (Figure 4a). The MPR25–GFP fusion protein expression construct was co-bombarded with a construct expressing red fluorescent protein (RFP) protein fused at the C-terminus of the targeting signal of the F1F0 ATPase c-subunit. The fluorescence of GFP overlapped with that of RFP, but did not co-localize with the auto-fluorescence of chloroplasts. (Figure 4a). To further confirm the subcellular localization of MPR25, MPR25 was fused to FLAG and stably expressed in transgenic rice cells. Immunoblot analysis of transgenic calli and leaves using anti-FLAG antibody detected the MPR25–FLAG fusion protein in the mitochondrial fraction extracted from calli, where we detected isocitrate dehydrogenase (IDH), which is known to localize in the mitochondrial matrix. MPR25–FLAG was not detected in the chloroplast fraction isolated from leaves, suggesting that MPR25 accumulates exclusively in mitochondria.

  • MPR25 is involved in C–U RNA editing of nad5 transcripts

PPR proteins bind to RNA in a sequence-specific manner and are involved in post-transcriptional RNA splicing, RNA editing or translational regulation. Most of the PPR proteins in the E, E/E+ and DYW subgroups are known to be involved in C–U RNA editing [3]. MPR25 belongs to the E subgroup, and thus is expected to be involved in RNA editing. In young rice seedlings, 491 sites have been reported to be edited in mitochondrial RNA and 21 sites in chloroplast RNA[4][5] . Of these, 472 editing sites are located within 34 protein-coding regions in mitochondria, while 20 sites within 10 proteincoding regions and one site within an untranslated region in chloroplasts. We performed direct sequence analysis of all 472 sites within 34 coding regions of mitochondrial cDNA and all 21 sites of chloroplast cDNA, using etiolated leaves of 4-week-old seedlings as a source of RNA. The primers used for RT-PCR and sequence analysis are listed in Table S1. cDNA sequence comparison between the mpr25 mutant and WTrevealed that one site within the nad5 transcripts was not edited in the mutant (Figure 5). Nucleotide 1580 in nad5 cDNA was edited to T in WT, but was left as C in the mpr25 mutant. An editing event at this site causes an amino acid change from serine to leucine. Based on the RNA editing site nomenclature proposed by Ru¨ dinger et al. [6], we named this site ‘nad5eU1580SL’. The absence of an editing event at nad5eU1580SL was also observed in green leaves from the mpr25 mutant (Figure 5). No changes in RNA editing efficiency were found at the other 471 sites in mitochondria, or the 21 sites in chloroplasts from etiolated leaves or green leaves. RNA editing at nad5eU1580SL was recovered in mpr25 transgenic plants expressing Ubi-MPR25, confirming that RNA editing of this site is dependent onMPR25 function.

  • Recombinant MPR25 proteins bind to nad5 transcripts

To confirm that the cis sequence of the nad5eU1580SL editing site is the direct target of the MPR25 protein, we performed electrophoresis mobility shift assays (EMSA). Mature MPR25 protein without N-terminal mitochondrialtargeting peptides was expressed in Escherichia coli in fusion with thioredoxin (Trx). The Trx-fused recombinant MPR25 protein (Trx-rMPR25) was incubated with digoxigenin- labeled RNA nucleotides spanning 35 nucleotide regions of nad5eU1580SL. The RNA probe included a sequence from )26 bp upstream to +8 bp downstream of the nad5eU1580SL editing site, excluding any other editing sites. Retardation of the RNA signal was observed only when the nad5 RNA probe was incubated with Trx-rMPR25, but not with Trx alone (Figure 6). We next performed competitive EMSA using non-labeled RNA probe with the same sequence. The signal intensity of the band decreased as the competitor concentration increased, suggesting specific interaction of MPR25 with the probe sequence. The shifted band almost disappeared when a 100-fold excess of the competitor was added (Figure 6). In contrast, retardation of the RNA signal was not observed when the nad7 RNA probe was incubated with Trx-rMPR25 (Figure 6). These results indicate that MPR25 is a trans-acting factor of nad5eU1580SL that directly interacts with the proximal region of the editing site of nad5 transcripts.

Expression

  • MPR25 was preferentially expressed in leaves. FLAG-tagged MPR25 accumulated in mitochondria but not in chloroplasts. Direct sequencing revealed that the mpr25 mutant fails to edit a C–U RNA editing site at nucleotide 1580 of nad5, which encodes a subunit of complex I (NADH dehydrogenase) of the respiratory chain in mitochondria. RNA editing of this site is responsible for a change in amino acid from serine to leucine. Recombinant MPR25 directly interacted with the proximal region of the editing site of nad5 transcripts. However, the NADH dehydrogenase activity of complex I was not affected in the mutant. By contrast, genes encoding alternative NADH dehydrogenases and alternative oxidase were up-regulated. The mpr25 mutant may therefore provide new information on the coordinated interaction between mitochondria and chloroplasts.

Others about the gene

  • The photosynthesis rate is lower in mpr25 mutants

To investigate whether photosynthesis was affected in the mpr25 mutant, we first measured the CO2 assimilation rate at a light intensity of 80, 300 or 1200 lmol photon m)2 sec)1). The CO2 assimilation rate was lower in the mpr25 mutant than in WT (Figure 3a). The difference was particularly significant at light intensities of 300 and 1200 lmol m)2 sec)1. However, the stomatal conductance was not significantly different (Figure 3b). These results indicate that the photosynthesis system was affected in the mpr25 mutants. We then examined photosynthesis electron transport using measurements of chlorophyll fluorescence [7] and P700 redox state [8]. Fv/Fm, the maximum operating efficiency of photosystem II (PSII), was not affected in the mpr25 mutant (Figure S2), but the quantum yield of PSII (FII) was decreased in the mutant (Figure S2). This decrease was caused by the increased value for non-photochemical quenching and the decreased value for photochemical quenching (Figure S2). These results indicate that the heat dissipation efficiency was up-regulated by a process in photosynthesis electron transport downstream of PSII that is impaired in the mpr25 mutant. The decrease of FII in the mutant led to increase in the P700 oxidation ratio (Figure S2). By contrast, the quantum yield of PSI (FI) in the mutant was similar to that in WT (Figure S2).

  • nad5eU1580SL editing is conserved in various plant species

As mentioned above, C–U RNA editing at nad5eU1580SL causes an amino acid replacement of serine by leucine. To estimate the importance of amino acid replacement for NAD5 function, we compared amino acid sequences of NAD5 from Oryza sativa, Arabidopsis thaliana, Brassica napus, Physcomitrella patens and Chlamydomonas reinhardtii. The amino acid sequences deduced from cDNA were conserved, with leucine present at the nad5eU1580SL site in each of the plant species examined (Figure 5b). C–U RNA editing of nad5 RNA occurs in A. thaliana and B. napus at the same sites as O. sativa nad5eU1580SL [9][10], whereas the genomic sequences encode leucine in P. patens and C. reinhardtii (Figure 5b). These results indicate that nad5eU1580SL RNA editing and encoding of leucine at this site is probably important for NAD5 function. MPR25 was expressed at an extremely high level in green leaves compared with other tissues and etiolated leaves (Figure 1b). To investigate whether nad5 was also highly transcribed in green leaves, and whether C–U RNA editing at the nad5eU1580SL site was specific to green leaves, we performed quantitative RT-PCR and direct sequence analysis of nad5 RNA in various WT tissues. Similar amounts of nad5 mRNA and complete C–U RNA editing at the nad5eU1580SL site were detected in leaves and roots of 4-week-old green seedlings, anthers, calli, seeds and leaves of etiolated seedlings (Figure S3). Thus, nad5 was not exclusively expressed in green leaves, and the C–U RNA editing event was not restricted to green leaves, indicating that low expression of MPR25 is sufficient to accomplish C–U RNA editing of nad5 in all tissues. We also investigated whether the steady-state amounts of nad5 mRNA were affected by disruption of MPR25. Quantitative RT-PCR showed that the amount of nad5 mRNA was not significantly different betweenWTand the mpr25 mutant in leaves of etiolated or green seedlings (Figure S4). Northern blot analysis in the etiolated seedlings showed that nad5 was expressed at a slightly higher level in the mpr25 mutant than in WT (Figure S4). These results indicate that nad5 mRNA stability was not significantly affected by the absence of C–U RNA editing at nad5eU1580SL in the mpr25 mutant.

  • NADH dehydrogenase activity of complex I was not affected

NAD5 is a subunit of NADH dehydrogenase complex I in the mitochondrial respiratory chain. To investigate whether the respiration rate was affected by the amino acid change in NAD5 due to the absence of RNA editing at nad5eU1580SL, we measured the O2 consumption rate of green leaves sampled from 4-week-old seedlings. The mean respiration rate of the mpr25 mutant was not significantly different from that of WT (Figure 7a). We then examined the activity of NADH dehydrogenase of complex I by a histochemical reaction using NADH as a substrate, after separation of mitochondrial respiratory complexes from calli by blue native PAGE. The result indicates that the activity of NADH dehydrogenase did not differ between WT and the mpr25 mutant (Figure 7b).

  • Internal/external NADH dehydrogenase and AOX genes were up-regulated

Plant mitochondria are known to have alternative dehydrogenases, namely internal and external NADH dehydrogenases . We performed an expression analysis of the internal NADH dehydrogenase genes NDB1, NDB2 and NDB3 and the external NADH dehydrogenase genes NDA1, NDA2 and NDC1 by quantitative RT-PCR. NDA1, NDB1, NDB2, NDB3 and NDC1 were expressed at a higher level in the leaves of 4-week-old seedlings of the mpr25 mutant compared with WT (Figure S5). We also analyzed the expression of ALTERNATIVE OXIDASE (AOX) genes, which are known to be mitochondrial stress markers[11][12]. Quantitative RT-PCR analysis showed that AOX1a transcripts in the leaves of 4-week-old seedlings of the mpr25 mutant increased fivefold in comparison with the level in WT, and that the level of AOX1c was doubled in comparison with the level in WT (Figure S6).

  • MPR25 is involved in nad5eU1580SL editing on mitochondrial transcripts

Mitochondrial respiratory chain complex I in plants is a multimeric enzyme of more than 40 subunits, encoded by both nuclear and mitochondrial genes [13]. Rice mitochondrial DNA encodes nine subunits of complex I (NAD1, NAD2, NAD3, NAD4, NAD4L, NAD5, NAD6, NAD7 and NAD9). The rice nad5 transcript comprises a protein-coding region of 2010 nucleotides, and is known to contain 11 editing sites at the nucleotides 1490, 1550, 1580, 1589, 1859, 1895, 1900, 1901, 1916, 1918 and 1958. MPR25 was shown to be involved in C–U RNA editing at nucleotide 1580 (nad5eU1580SL) (Figures 5 and S3), but disruption of MPR25 did not affect the editing efficiency of other sites in nad5. There have been a few reports on editing factors of nad5 transcripts: A. thaliana MEF8 and MEF29, Physcomitrella patens PpPPR_91 and PpPPR_79, and maize PPR2263[13][14][15][16]. MEF8 has been reported to be involved in editing nucleotide 676 of Arabidopsis nad5. Mutants with MEF8 disruption did not exhibit any phenotypic changes[15]. Physcomitrella PpPPR_91 was reported to be the editing factor for nucleotide 598 (C) within the nad5 transcript, whereas PpPPR_79 was reported to be involved in editing of nucleotide 730 (C) in the nad5 transcript. Ppppr_91 and Ppppr_79 mutants exhibited severe growth retardation [14][16]. Maize PPR2263 and Arabidopsis MEF29 encode DYW domain-containing PPR proteins, and are required for RNA editing of nad5 and cob transcripts at nucleotides 1550 and 908, respectively[17]. The ppr2263 mutation was reported to cause growth defects in kernels and seedlings of maize. The rice nad5eU1580SL site is also known to be edited in A. thaliana (Figure 5). The Arabidopsis MPR25 ortholog is At3g22150, although the function of this gene in Arabidopsis has not yet been reported. Reports on rice PPR mutants have been limited to OsPPR1 [18]andOGR1. OsPPR1 was reported to be related to chloroplast development, but its molecular function remains to be elucidated . The ogr1 mutant shows growth retardation and fewer tillering. OGR1 belongs to the DYWsubgroup, and was shown to be localized to mitochondria and involved in C–U RNA editing at multiple sites in cox2, cox3, ccmC, nad2 and nad4 transcripts [19]. The mpr25 mutant and the ogr1 mutant showed growth retardation in that the defect of C–U RNA editing of the mitochondrial gene is considered to be involved in plant development.

  • MPR25 is localized to mitochondria but also related to chloroplast function

RNA editing of the nad5eU1580SL site in mitochondria was abolished in the mpr25 mutant, resulting in lack of the serine to leucine amino acid substitution (Figure 5). This leucine residue is conserved in various plant species and is probably important for NAD5 function (Figure 5). However, the NADH dehydrogenase activity of complex I and the respiration rate of the mpr25 mutant were not significantly different from those of WT (Figure 7). By contrast, genes for alternative NADH dehydrogenases and alternative oxidase were up-regulated in the mutants (Figures S5 and S6). Such alternative pathways, which bypass proton transport across the membrane, may affect ATP production in the electron transport chain. Defects in the mitochondrial electron transport chain are likely to be responsible for the growth retardation phenotype of the mpr25 mutant. Similar defects in plant growth have also been reported in other complex I mutants [11][12] [19] [20][21] [22][23][24].For example, a nad1 intron 1 splicing-deficient mutant, otp43, of Arabidopsis exhibited delayed development and flowering phenotype[23]; the slo1 mutant of Arabidopsis also showed slow growth and late germination. SLO1 encodes an E group PPR protein, and requires C–U RNA editing at nucleotide 449 of nad4 and nucleotide 328 of nad9[24]. MEF9, an E subclass PPR protein, is required for an RNA editing event in nad7 transcripts in Arabidopsis. Mutant mef9-2 displayed slow growth, with bolting and flower set delayed by 2 weeks [15]. Growth retardation was also reported in the slg mutant of Arabidopsis. SLG1 belongs to the E subgroup of PPRs, and was shown to participate in C–U RNA editing of nad3 transcripts [25]. However, a defective phenotype was not apparent in the case of a mef1 mutant, although MEF1 encodes a DYW group PPR protein and C–U RNA editing was abolished at editing sites in nad2, nad7 and rps4 transcripts of the mef1 mutant [26]. Complementation of the respiratory rate by an increase in the activity of alternative NADH dehydrogenases and AOX capacity has also been reported in the Nicotiana sylvestris cytoplasmic male sterile (CMS) II mutant, which lacks nad7 [22], and the nadfs4 mutant, which lacks complex I [27]. The photosynthetic rate was significantly reduced in the mpr25 mutants (Figure 3). Similar reduction of photosynthetic activity has also been reported in a CMSII mutant lacking nad7 [22], and in an NMS1 mutant, which lacks splicing of the first intron of nad4[12]. However, the reasons why photosynthesis is affected by defects in mitochondrial complex I are still unclear. In the nadfs4 mutant of Arabidopsis lacking complex I, the activity of PSII and the electron transport rate were significantly reduced, especially under low irradiance, with non-photochemical quenching being enhanced[27]. The photosynthesis rate was more severely impaired when non-photochemical quenching was enhanced under increased light conditions in the mpr25 mutant. NAD5 regulation by MPR25 may be considered to be involved in processes related to photorespiration or the malate/oxaloacetic acid shuttle, which has a role in the dissipation of excess reducing power from chloroplasts [8] [28]. Alternatively, defects of mitochondrial complex I may have some retrograde action that influences nuclear gene expression of some plastid functions; in addition, impaired metabolite shuttling from the chloroplasts to the mitochondria may induce a stress on photosynthetic activity in mutant plants [29]. Further physiological and biochemical analysis of the mpr25 mutant will elucidate new aspects of the coordinated interaction between mitochondria and chloroplasts.

Supporting Information

Additional Supporting Information may be found in the online version of this article: Figure S1. Phenotype of the mpr25 mutant grown in the dark. Figure S2. Effect of light intensity on the chlorophyll fluorescence parameters and P700 redox state in the mpr25 mutant. Figure S3. Editing and expression of nad5 in various tissues. Figure S4. nad5 expression in the mpr25 mutant. Figure S5. Expression analysis of alternative NADH dehydrogenase genes. Figure S6. Expression analysis of AOX genes. Figure S7. SDS–PAGE of purified recombinant MPR25 protein. Table S1. Primers used for RT-PCR and sequence analysis. Please note: As a service to our authors and readers, this journal provides supporting information supplied by the authors. Such materials are peer-reviewed and may be re-organized for online delivery, but are not copy-edited or typeset. Technical support issues arising from supporting information (other than missing files) should be addressed to the authors.

Labs working on this gene

  • Laboratory of Environmental Plant Biotechnology, Graduate School of Agricultural Science, Tohoku University, 1-1 Tsutsumidori-Amamiyamachi, Aoba-ku, Sendai 981-8555, Japan
  • Department of Biological Sciences, Graduate School of Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku,Tokyo 113-0033, Japan


References

  1. Takushi Toda, Sota Fujii, Ko Noguchi, Tomohiko Kazama and Kinya Toriyama.(2012) Rice MPR25 encodes a pentatricopeptide repeat protein and is essential for RNA editing of nad5 transcripts in mitochondria.The Plant Journal,72,450-460.
  2. Lurin, C., Andres, C., Aubourg, S. et al. (2004) Genome-wide analysis of Arabidopsis pentatricopeptide repeat proteins reveals their essential role in organelle biogenesis. Plant Cell, 16, 2089–2103.
  3. Fujii, S. and Small, I. (2011) The evolution of RNA editing and pentatricopeptide repeat genes. New Phytol. 191, 37–47.
  4. Corneille, S., Lutz, K. and Maliga, P. (2000) Conservation of RNA editing between rice and maize plastids: are most editing events dispensable? Mol. Gen. Genet. 264, 419–424.
  5. Notsu, Y., Masood, S., Nishikawa, T., Kubo, N., Akiduki, G., Nakazono, M., Hirai, A. and Kadowaki, K. (2002) The complete sequence of the rice (Oryza sativa L.) mitochondrial genome: frequent DNA sequence acquisition and loss during the evolution of flowering plants. Mol. Genet. Genomics 268, 434–445.
  6. Ru¨ dinger, M., Funk, H.T., Rensing, S.A., Maier, U.G. and Knoop, V. (2009) RNA editing: only eleven sites are present in the Physcomitrella patens mitochondrial transcriptome and a universal nomenclature proposal. Mol. Genet. Genomics 281, 473–481.
  7. Baker, N.R. (2008)Chlorophyll fluorescence: a probe of photosynthesis in vivo. Annu. Rev. Plant Biol. 59, 89–113.
  8. 8.0 8.1 Yoshida, K., Terashima, I. and Noguchi, K. (2007) Up-regulation of mitochondrial alternative oxidase concomitant with chloroplast over-reduction by excess light. Plant Cell Physiol. 48, 606–614.
  9. Giege, P. and Brennicke, A. (1999) RNA editing in Arabidopsis mitochondria effects 441 C to U changes in ORFs. Proc. Natl. Acad. Sci. USA, 21, 15324– 15329.
  10. Handa, H. (2003) The complete nucleotide sequence and RNA editing content of the mitochondrial genome of rapeseed (Brassica napus L.): comparative analysis of the mitochondrial genomes of rapeseed and Arabidopsis thaliana. Nucleic Acids Res. 31, 5907–5916.
  11. 11.0 11.1 Gutierres, S., Sabar, M., Lelandais, C., Chetrit, P., Diolez, P., Degand, H., Boutry, M., Vedel, F., de Kouchkovsky, Y. and de Paepe, R. (1997) Lack of mitochondrial and nuclear-encoded subunits of complex I and alteration of the respiratory chain in Nicotiana sylvestris mitochondrial deletion mutants. Proc. Natl Acad. Sci. USA, 94, 3436–3441.
  12. 12.0 12.1 12.2 Sabar, M., de Paepe, R. and de Kouchkovsky, Y. (2000) Complex I impairment, respiratory compensations, and photosynthetic decrease in nuclear and mitochondrial male sterile mutants of Nicotiana sylvestris. Plant Physiol. 124, 1239–1249.
  13. 13.0 13.1 Klodman, J., Sunderhaus, S., Nimtz, M., Ja¨ nsch, L. and Braun, H.P. (2010) Internal architecture of mitochondrial complex I from Arabidopsis thaliana. Plant Cell, 22, 797–810.
  14. 14.0 14.1 Ohtani, S., Ichinose, M., Tasaki, E., Aoki, Y., Komura, Y. and Sugita, M. (2010) Targeted gene disruption identifies three PPR-DYW proteins involved in RNA editing for five editing sites of the moss mitochondrial transcripts. Plant Cell Physiol. 51, 1942–1949.
  15. 15.0 15.1 15.2 Takenaka, M., Verbitskiy, D., Zehrmann, A. and Brennicke, A. (2010) Reverse genetic screening identifies five E-class PPR-proteins involved in RNA editing in mitochondria of Arabidopsis thaliana. J. Biol. Chem. 285, 27122– 27129.
  16. 16.0 16.1 Uchida, M., Ohtani, S., Ichiose, M., Sugita, C. and Sugita, M. (2011) The PPRDYW proteins are required for RNA editing of rps14, cox1 and nad5 transcripts in Physcomitrella patens mitochondria. FEBS Lett. 585, 2367–2371.
  17. Sosso, D., Mbelo, S., Vernoud, V. et al. (2012) PPR2263, a DYW-subgroup pentatricopeptide repeat protein, is required for mitochondrial nad5 and cob transcript editing, mitochondrion biogenesis, and maize growth. Plant Cell, 24, 676–691.
  18. Gothandam, K.M., Kim, E.-S., Cho, H. and Chung, Y.-Y. (2005) OsPPR1, a pentatricopeptide repeat protein of rice is essential for the chloroplast biogenesis. Plant Mol. Biol. 58, 421–433.
  19. 19.0 19.1 Kim, S.-R., Yang, J.-I., Moon, S., Ryu, C.-H., An, K., Kim, K.-M., Yim, J. and An, G. (2009) Rice OGR1 encodes a pentatricopeptide repeat-DYW protein and is essential for RNA editing in mitochondria. Plant J. 59, 738–749.
  20. Brangeon, J., Sabar, M., Gutierres, S. et al. (2000) Defective splicing of the first nad4 intron is associated with lack of several complex I subunits in the Nicotiana sylvestris NMS1 nuclear mutant. Plant J. 21, 269–280.
  21. Lee, B.-H., Lee, H., Xiong, L. and Zhu, J.-K. (2002) A mitochondrial complex I defect impairs cold-regulated nuclear gene expression. Plant Cell, 14, 1235–1251.
  22. 22.0 22.1 22.2 Pineau, B., Mathieu, C., Gerard-Hirne, C., de Paepe, R. and Chetrit, P. (2005) Targeting the NAD7 subunit to mitochondria restores a functional complex I and a wild type phenotype in the Nicotiana sylvestris CMS II mutant lacking nad7. J. Biol. Chem. 280, 25994–26001.
  23. 23.0 23.1 Falcon de Longevialle, A., Meyer, E.H., Andres, C., Taylor, N.L., Lurin, C., Millar, A.H. and Small, I.D. (2007) The pentatricopeptide repeat gene OTP43 is required for trans-splicing of the Mitochondrial nad1 intron 1 in Arabidopsis thaliana. Plant Cell, 19, 3256–3265.
  24. 24.0 24.1 Sung, T.-Z., Tseng, C.-C. and Hsieh, M.-H. (2010) The SLO1 PPR protein is required for RNA editing at multiple sites with similar upstream sequences in Arabidopsis mitochondria. Plant J. 63, 499–511.
  25. Yuan, H. and Liu, D. (2012) Functional disruption of the pentatricopeptide protein SLG1 affects mitochondrial RNA editing, plant development, and response to abiotic stresses in Arabidopsis. Plant J. 70, 432–444.
  26. Zehrmann, A., Verbitskiy, D., van der Merwe, J.A., Brennicke, A. and Takenaka, M. (2009) A DYW domain-containing pentatricopeptide repeat protein is required for RNA editing at multiple sites in mitochondria of Arabidopsis thaliana. Plant Cell, 21, 558–567.
  27. 27.0 27.1 Meyer, E.H., Tomaz, T., Carroll, A.J., Estavillo, G., Delannoy, E., Tanz, S.K., Small, I.D., Pogson, B.J. and Millar, A.H. (2009) Remodeled respiration in ndufs4 with low phosphorylation efficiency suppresses Arabidopsis germination and growth and alters control of metabolism at night. Plant Physiol. 151, 603–619.
  28. Noguchi, K. and Yoshida, K. (2008) Interaction between photosynthesis and respiration in illuminated leaves. Mitochondrion, 8, 87–99.
  29. Rasmusson, A.G. and Wallstrom, S.V. (2010) Involvement of mitochondria in the control of plant cell NAD(P)H reduction levels. Biochem. Soc. Trans. 38, 661–666.

Structured Information

Gene Name

Os04g0602600

Description

Protein prenyltransferase domain containing protein

Version

NM_001060309.1 GI:115460347 GeneID:4336891

Length

3056 bp

Definition

Oryza sativa Japonica Group Os04g0602600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:30808628..30811683

Sequence Coding Region

30808751..30811165

Expression

GEO Profiles:Os04g0602600

Genome Context

<gbrowseImage1> name=NC_008397:30808628..30811683 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:30808628..30811683 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcctctcctcgctgcgccgtctcgctcccacccaccgccgcggcgaccaccgccaccaatggcggaggcggcgggaggaggaacgcgcagccggcagcggcgacggcggcgtcgcaggtgaagaagctgtgcaagcaggggcggctggaccacgcgcggcggctgctcctcgaggcgcttccccggccgccaccgacgctgctctgcaacgcgctcctcatcgcctacgccgcccgcgcgctcccggaggaggcgctccgcctctacgctctcctcaaccacgccgcgcgcccgccggtccgctccgaccactacacctactccgccgcgctcaccgcctgcgcacgctcccgccgcctccgcctcgggaggtccgtccacgcgcacatgctccggcgcgcccgctccctcccggacaccgccgtcctccgcaactccctcctcaacctctacgcctccagcgtgcggtaccgggaggcacgcgtcgacgtcgtccggaggctgttcgacgcaatgcctaagaggaacgtggtttcttggaacactctgttcggctggtacgtcaagaccgggcgtccccaggaagccctggagctgtttgtgcgcatgctagaagatggtttcaggcccacgccggtcagcttcgtgaatatatttccggctgctgtggctgacgatccaagctggccattccagctctacggattacttgtgaagtatggggtagagtatatcaacgatctgtttgttgtgagctcagcaatcgacatgttctccgaatttggggatgtgcaatcagctcggagggtgtttgatcgtgctgccaagaagaacaccgaggtttggaacaccatgatcactgggtatgtacagaatggccagttttctgaagccattgatctcttcagcaaaatcttgggatcccgagaggttccattggatgttgtgaccttcttatcggccctcacagctgcctcacagtcacaggatgttagcttgggtcagcagctgcatggctatttgattaaaggaatgcataggacattgcctgtaatactcggtaatgcacttgttgtgatgtactcaagatgtggcaatgtccaaactgcctttgatctcttcgaccggttgccagagaaggacattgttacttggaataccatggtgactgcttttatacagaacgattttgacttggaaggcttgctgctcgtctatgagatgcagaaatcaggttttgctgctgattctgtgacattgactgcagttctgtcagcatcatcaaatactggagaccttcagatcggtaaacaagcacatggttatcttatcaggcatggtatcgagggtgagggcttggagagctacctaatagacatgtatgcaaaatctggccgtgtagaaatggctcagagagtgtttgatagctttaaaaatgccaagagggatgaagtcacttggaatgccatgatagcgggatacacacagagtggacagcctgaaaaggcaatcttagtattccgggcaatgcttgaggcaggtcttgaacctacttcggtgacacttgcttcggtgctacctgcatgtgatcctgttggagggggcgtttattctgggaagcaaatccactgttttgctgtgcgccgttgtttggataccaatgtcttcgtaggtacagctcttattgacatgtactctaagtgtggtgagatcactacagcagaaaatgtctttggtggcatgacggggaagagcactgtcacctatacgacaatgatatctggtcttggtcagcatggtttcggcaaaaaagcgcttgctcttttcaactccatgcaagaaaaggggttgaagcctgatgcagtgaccttcttgtctgcgatttcagcatgtaattactctggactcgtcgacgaaggactagctttgtacaggtcgatggactcatttggaatttcggctactcctcagcaccactgctgtgttgcagacttgttagctaaagctggaagggtggaggaagcatacgagtttatagaggggctgggggaggagggcaactttgttgccatctggggatcgctgcttgcatcctgcaaagctcagggcaagcaagagttggcaaagttggtgaccaagaagctgcttgacatcgagaagcagtacggtcatgcaggctacagcgttttgttgtcacaggtccttgctgctgaaagtaactggaatagtgctgatagtctaagaaaggagatgagggcaaggggattgaagaaagaagcaggttctagttggattaaagtccagaacgcagcattggaacacaagtttatcgaaaaagaccaaaattatgtcgaaaatgagcacatgttctcgattctggatggtgatgccgacagtacggatagactttaa</cdnaseq>

Protein Sequence

<aaseq>MSSPRCAVSLPPTAAATTATNGGGGGRRNAQPAAATAASQVKKL CKQGRLDHARRLLLEALPRPPPTLLCNALLIAYAARALPEEALRLYALLNHAARPPVR SDHYTYSAALTACARSRRLRLGRSVHAHMLRRARSLPDTAVLRNSLLNLYASSVRYRE ARVDVVRRLFDAMPKRNVVSWNTLFGWYVKTGRPQEALELFVRMLEDGFRPTPVSFVN IFPAAVADDPSWPFQLYGLLVKYGVEYINDLFVVSSAIDMFSEFGDVQSARRVFDRAA KKNTEVWNTMITGYVQNGQFSEAIDLFSKILGSREVPLDVVTFLSALTAASQSQDVSL GQQLHGYLIKGMHRTLPVILGNALVVMYSRCGNVQTAFDLFDRLPEKDIVTWNTMVTA FIQNDFDLEGLLLVYEMQKSGFAADSVTLTAVLSASSNTGDLQIGKQAHGYLIRHGIE GEGLESYLIDMYAKSGRVEMAQRVFDSFKNAKRDEVTWNAMIAGYTQSGQPEKAILVF RAMLEAGLEPTSVTLASVLPACDPVGGGVYSGKQIHCFAVRRCLDTNVFVGTALIDMY SKCGEITTAENVFGGMTGKSTVTYTTMISGLGQHGFGKKALALFNSMQEKGLKPDAVT FLSAISACNYSGLVDEGLALYRSMDSFGISATPQHHCCVADLLAKAGRVEEAYEFIEG LGEEGNFVAIWGSLLASCKAQGKQELAKLVTKKLLDIEKQYGHAGYSVLLSQVLAAES NWNSADSLRKEMRARGLKKEAGSSWIKVQNAALEHKFIEKDQNYVENEHMFSILDGDA DSTDRL</aaseq>

Gene Sequence

<dnaseqindica>124..2538#atcgaatcgtctgtggcgcccgcgaagcaacggaagagatgaggagatgactcggatgagcggaagctgcagggagcgagtcgtcgtcgtcgtcgtcaccgcgaggcgccgcgccaacctctcatgtcctctcctcgctgcgccgtctcgctcccacccaccgccgcggcgaccaccgccaccaatggcggaggcggcgggaggaggaacgcgcagccggcagcggcgacggcggcgtcgcaggtgaagaagctgtgcaagcaggggcggctggaccacgcgcggcggctgctcctcgaggcgcttccccggccgccaccgacgctgctctgcaacgcgctcctcatcgcctacgccgcccgcgcgctcccggaggaggcgctccgcctctacgctctcctcaaccacgccgcgcgcccgccggtccgctccgaccactacacctactccgccgcgctcaccgcctgcgcacgctcccgccgcctccgcctcgggaggtccgtccacgcgcacatgctccggcgcgcccgctccctcccggacaccgccgtcctccgcaactccctcctcaacctctacgcctccagcgtgcggtaccgggaggcacgcgtcgacgtcgtccggaggctgttcgacgcaatgcctaagaggaacgtggtttcttggaacactctgttcggctggtacgtcaagaccgggcgtccccaggaagccctggagctgtttgtgcgcatgctagaagatggtttcaggcccacgccggtcagcttcgtgaatatatttccggctgctgtggctgacgatccaagctggccattccagctctacggattacttgtgaagtatggggtagagtatatcaacgatctgtttgttgtgagctcagcaatcgacatgttctccgaatttggggatgtgcaatcagctcggagggtgtttgatcgtgctgccaagaagaacaccgaggtttggaacaccatgatcactgggtatgtacagaatggccagttttctgaagccattgatctcttcagcaaaatcttgggatcccgagaggttccattggatgttgtgaccttcttatcggccctcacagctgcctcacagtcacaggatgttagcttgggtcagcagctgcatggctatttgattaaaggaatgcataggacattgcctgtaatactcggtaatgcacttgttgtgatgtactcaagatgtggcaatgtccaaactgcctttgatctcttcgaccggttgccagagaaggacattgttacttggaataccatggtgactgcttttatacagaacgattttgacttggaaggcttgctgctcgtctatgagatgcagaaatcaggttttgctgctgattctgtgacattgactgcagttctgtcagcatcatcaaatactggagaccttcagatcggtaaacaagcacatggttatcttatcaggcatggtatcgagggtgagggcttggagagctacctaatagacatgtatgcaaaatctggccgtgtagaaatggctcagagagtgtttgatagctttaaaaatgccaagagggatgaagtcacttggaatgccatgatagcgggatacacacagagtggacagcctgaaaaggcaatcttagtattccgggcaatgcttgaggcaggtcttgaacctacttcggtgacacttgcttcggtgctacctgcatgtgatcctgttggagggggcgtttattctgggaagcaaatccactgttttgctgtgcgccgttgtttggataccaatgtcttcgtaggtacagctcttattgacatgtactctaagtgtggtgagatcactacagcagaaaatgtctttggtggcatgacggggaagagcactgtcacctatacgacaatgatatctggtcttggtcagcatggtttcggcaaaaaagcgcttgctcttttcaactccatgcaagaaaaggggttgaagcctgatgcagtgaccttcttgtctgcgatttcagcatgtaattactctggactcgtcgacgaaggactagctttgtacaggtcgatggactcatttggaatttcggctactcctcagcaccactgctgtgttgcagacttgttagctaaagctggaagggtggaggaagcatacgagtttatagaggggctgggggaggagggcaactttgttgccatctggggatcgctgcttgcatcctgcaaagctcagggcaagcaagagttggcaaagttggtgaccaagaagctgcttgacatcgagaagcagtacggtcatgcaggctacagcgttttgttgtcacaggtccttgctgctgaaagtaactggaatagtgctgatagtctaagaaaggagatgagggcaaggggattgaagaaagaagcaggttctagttggattaaagtccagaacgcagcattggaacacaagtttatcgaaaaagaccaaaattatgtcgaaaatgagcacatgttctcgattctggatggtgatgccgacagtacggatagactttaacatgtttcaataccttttggcacgcaagattgcagatatgagattcctaatcctattgtggtgattacctcacgctgacagactaggctcctgttttacctgcagtttaacatgatttatcttcattcagaaatcagaattgatgctcctcatagtaatacttgactggatggaaacttggaaagacacctagcccacaaacctcatgcggcggccacacggtgaacttgtgctgcgagacatcaatctatggatgaggttgataccaatgatgtgccagatgaagagcaagctgcaatcttgcaggtggccaggttgtaacttgtattcagtagtacgcatatcttgacaagcacagcgccctccttagggattctgggtgaattgtacagctacatttgcttataatcgtctagaaataggtgagtactgtcatagaacgagcaacgtgattaggcaacgggattttttttggttgtgaacgtacatacaatatcttaaatgaagattattctcac</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0602600, RefSeq:Os04g0602600