Os10g0496900

From RiceWiki
Revision as of 01:50, 10 June 2014 by Yueliya (talk | contribs) (Expression)
Jump to: navigation, search

The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions.

Annotated Information

Function

OsPORB is essential for maintaining light-dependent Chl synthesis throughout leaf development, especially under HL conditions. The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions. NADPH:protochlorophyllide oxidoreductase (POR) catalyzes photoreduction of protochlorophyllide (Pchlide) to chlorophyllide in chlorophyll (Chl) synthesis, and is required for prolamellar body (PLB) formation in etioplasts.

Rice faded green leaf (fgl) mutants develop yellow/white leaf variegation and necrotic lesions during leaf elongation in field-grown plants. Map-based cloning revealed that FGL encodes OsPORB, one of two rice POR isoforms. In fgl, etiolated seedlings contained smaller PLBs in etioplasts, and lower levels of total and photoactive Pchlide. Under constant or high light (HL) conditions, newly emerging green leaves rapidly turned yellow and formed lesions. Increased levels of non-photoactive Pchlide, which acts as a photosensitizer, may cause reactive oxygen accumulation and lesion formation.

fgl harbors a 1-bp deletion in the coding region of OsPORB, resulting in a frameshift mutation and premature translational termination. Based on the expression analysis of two OsPOR genes and phenotypic characterization of the fgl mutant, Yasuhito Sakurabaet al[1] proposed that OsPORB plays important roles in maintaining a threshold Chl level throughout leaf development, especially under HL field conditions.

Expression

OsPORB expression is regulated in a circadian rhythm in short-day conditions. OsPORA was expressed at high levels in developing leaves and decreased dramatically in fully mature leaves, whereas OsPORB expression was relatively constant throughout leaf development. However, OsPORB expression is rapidly upregulated by HL treatment.


OsPORB is not required for light-dependent Chl synthesis during greening of etiolated plantsFigure 1. Abundance of OsPOR transcripts and OsPOR proteins during the greening of etiolated seedlings.Figure 1. Abundance of OsPOR transcripts and OsPOR proteins during the greening of etiolated seedlings.

First, Sakuraba et al examined the effect of light on OsPOR expression during greening. When 6–day-old etiolated wild-type seedlings were exposed to light for 24 h, OsPORA expression was rapidly downregulated after illumination, whereas OsPORB expression decreased only slightly (Figure 1a). Consistent with its mRNA levels, OsPORA protein levels were severely reduced after 6 h of light treatment, and were maintained at low levels until 12 h in both wild-type and fgl seedlings (Figure 1b). OsPORB remained relatively constant in the wild type, but OsPORB did not accumulate in fgl because of the frameshift mutation in OsPORB. Next, to examine whether OsPORA contributes to light-dependent Chl synthesis during leaf greening, Sakuraba et al compared the greening speed of wild-type and fgl seedlings. The visible speed of greening (Figure 1c) and the rates of Chl synthesis (Figure 1d) were not significantly altered in fgl, indicating that low levels of OsPORA are sufficient for leaf greening in rice, even in the absence of OsPORB activity in fgl mutants.


Enhanced OsPORB activity is essential for Chl synthesis under HL.

Figure 2. Effect of high light(HL) on Chl synthesis and OsPOR expression.

In Arabidopsis, AtPORC expression increases under HL conditions, whereas both AtPORA and AtPORB are downregulated (Masuda et al., 2003), indicating that AtPORC is responsible for Chl synthesis under HL conditions. Thus, Sakuraba et al examined whether OsPORB has a similar function to AtPORC for Chl synthesis in response to HL.

The 14–day-old wild-type and fgl seedlings grown under mild light intensity (200 μmol m−2 s−1) were transferred to HL (1500 μmol m−2 s−1) for 3 days in SD conditions (Figure 2). Compared with the wild type, fgl exhibited a severely photobleached phenotype (Figure 2a,b), possibly as a result of photooxidative damage. In the wild type, OsPORA mRNA levels were lower after 3 h of HL treatment (Figure 2c), whereas OsPORB mRNA levels drastically increased (Figure 2d), indicating that the rice plant requires increased expression of OsPORB in response to HL conditions. The levels of OsPORA and OsPORB were consistent with their mRNA levels (Figure 2e), indicating that rice POR activity is regulated at the transcriptional level.

These results strongly suggest that OsPORB activity is necessary for Chl synthesis under HL conditions in the paddy field, reminiscent of AtPORC function in Arabidopsis (Masuda et al., 2003).


.

Evolution

Phylogenetic tree of PORs in Arabidopsis, rice and barley.

Figure 2. Phylogenetic tree of PORs in Arabidopsis, rice and barley.

Labs working on this gene

Department of Plant Science, Plant Genomics and Breeding Institute, Research Institute for Agriculture and Life Sciences,Seoul National University, Seoul 151-921, Korea

References

1.Yasuhito Sakuraba;Md Lutfor Rahman;Sung-Hwan Cho;Ye-Sol Kim;Hee-Jong Koh;Soo-Cheul Yoo;Nam-Chon Paek

The rice faded green leaf locus encodes protochlorophyllide oxidoreductase B and is essential for chlorophyll synthesis under high light conditions
The Plant Journal, 2013, 74(1): 122-133

2.Qiaosong Yang;Han He;Heying Li;Hua Tian;Jianjun Zhang;Liguang Zhai;Jiandong Chen;Hong Wu;Ganjun Yi;Zheng-Hui He;Xinxiang Peng

NOA1 Functions in a Temperature-Dependent Manner to Regulate Chlorophyll Biosynthesis and Rubisco Formation in Rice
PLoS ONE, 2011, 6(5): e20015

Structured Information

Gene Name

Os10g0496900

Description

Similar to NADPH:protochlorophyllide oxidoreductase porB (Fragment)

Version

NM_001071490.1 GI:115482723 GeneID:4349004

Length

3713 bp

Definition

Oryza sativa Japonica Group Os10g0496900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:19357502..19361214

Sequence Coding Region

19359252..19359591,19360224..19360750

Expression

GEO Profiles:Os10g0496900

Genome Context

<gbrowseImage1> name=NC_008403:19357502..19361214 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:19357502..19361214 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggtgccgcgacttcctcaaggcgtcgcgcgccgccaaggccgccggcatggagaagggcagctacaccatcgtccacctcgacctggcgtcgctcgacagcgtcaggcagttcgtcgccaacgtccggcggctggagatgcccgtcgacgtggtggtgtgcaacgccgccgtgtaccagcccaccgccaagcagccgagcttcaccgccgacggcttcgagatgagcgtcggcgtcaaccacctcgggcacttcctcctcgcccgcgagctcctcgccgacctcacctcctccgactacccctccaagcgcctcatcatcgtcggctccatcaccgggaacacgaacacgctggcggggaacgtgccgccgaaggcgaacctgggggacctccgggggctcgcctcgggcctcgacggcgtgtcgagctccgccatgatcgacggcggcgagttcgacggcgccaaggcctacaaggacagcaaggtgtgcaacatgctgacgatgcaggagttccaccgccggtaccacggcgagaccggggtgacgttcgcgtcgctctaccccgggtgcatcgccaccacgggcctcttccgggagcacgtcccgctgttccgcctcctcttcccgcccttccagaagtacatcaccaagggctacgtctccgaggaggaggccggcaagcggctggcccaggtcgtcagtgaccccagcctcaccaagtccggggtgtactggagctggaacaacaactcggcctcgttcgagaaccagctctccgaggaggcctccgatccggagaaggccaagaaggtctgggagctcagcgagaagctcgtcggcttggccgatcacgatcagtga</cdnaseq>

Protein Sequence

<aaseq>MGCRDFLKASRAAKAAGMEKGSYTIVHLDLASLDSVRQFVANVR RLEMPVDVVVCNAAVYQPTAKQPSFTADGFEMSVGVNHLGHFLLARELLADLTSSDYP SKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLASGLDGVSSSAMIDGGEFDGAKAYK DSKVCNMLTMQEFHRRYHGETGVTFASLYPGCIATTGLFREHVPLFRLLFPPFQKYIT KGYVSEEEAGKRLAQVVSDPSLTKSGVYWSWNNNSASFENQLSEEASDPEKAKKVWEL SEKLVGLADHDQ</aaseq>

Gene Sequence

<dnaseqindica>1751..2090#2723..3249#agcttagaaccccaaccccccaaagcctcactcacttcgctgcagaggaaaaaaaagagagaaaaatctccgatggctctccaggcggccaccaccacctccttcctcccctccgcgctctccgcccgcaaggaggtgagagctctaagctcggggattcagccatggaggcatttcagagttcagactagttcagagttttgcttcgtgttcatggcggcgattggttaaatggttttttttttgtttttgggttggtttttgggggtgtagggagcggtgaaggactcggcgttcttgggcgttcgtctcggcgacgggctcaagctggagaccagtgctctcggccttcgcaccaaggtagtaactgtaataatgttgttacagcactctgcttgctctgtgctgatgctctgtttgttagtgctaatattagtacttactactaactggcgagtagtacaagtaattggctagttcgttcagtgaattgccaggttttcgtttctagacttcacgattattagtttcagactttcagttatgttggaggagcttaccactgtggctctgtggtttgctctgtcagattaggagcacccgtggcgttgcaaatggttatgcctgtgtttggcattaatcaactggctaatgagattatatcatgatgattctctcatcgttttagctatgacaatgtcaggggcttgttttgttttcacaggtgtgcagctttgctaattgctagtaacatcagtgtgtgccgccattgttagtgcaaccaagtagcctttgtgtctggttaatttgcaacttcaggttgacatttggacttgctgagtgagtgtatctagcattgcaaactgatgtgaattttgacgaacttttagtgcaagattgcaaggtttgcttgatgtacttagaaatggtagttgctcacaactctgacagcgccacaaaaattgtattatacttgattagcctggcattttgacttcctattgatctggattttatgtcagtgttagtttgagtatatatagcattgcaaagtgatgcgaatttgggtaacttttagtgcaagattgcaaggtttacttgctgtacttagaaatagttgctcaaaactctgacatcgccacacccccaaaaaattgtactactacttaattagctttggcatttcaagttcatattgatgtggatcgatttcataaacttgattttactgcaagactgtcaagtttgctccctgtaatttcataaacttggttccgcatgtaaactagacgaatttattaagcctaattaatccatcattagtaaatatttattgtagcatcacattattaaatcatagcataattagattcaaaagatttgtctcacaatttacatataaactgtgcaattatttttttccccacatttaatattcttgcatgttcaaacatttgatgtgatgtttttggccaaaaaattttttatataaaaacaaaggcctagtttgttcatatatcttgacattgttgccacgaaaactgaaactctcctgcagagggtgagcacgtcgtcggtggccatccgcgcgcaggcgtcggcggcggtgtcgtccccgacggtgacgccggcgtcgccgtcgggcaagcagacgctgcgcaagggcacggcggtcatcaccggcgcgtcgtccgggcttggcctcgcgacggcgaaggcgctggcggagacgggcaggtggcacgtcgtcatggggtgccgcgacttcctcaaggcgtcgcgcgccgccaaggccgccggcatggagaagggcagctacaccatcgtccacctcgacctggcgtcgctcgacagcgtcaggcagttcgtcgccaacgtccggcggctggagatgcccgtcgacgtggtggtgtgcaacgccgccgtgtaccagcccaccgccaagcagccgagcttcaccgccgacggcttcgagatgagcgtcggcgtcaaccacctcgggcacttcctcctcgcccgcgagctcctcgccgacctcacctcctccgactacccctccaagcgcctcatcatcgtcggctccatcaccggtaatgacaacctttcttcctcaccagaattaggctgttgtgttctaatgtcaaagcttccaacttctactattttgtagttctccacgtacacaattactacaattactgaactgctaaaaattgcatgttttataaaaaaaattataggaagttgttgtgattaatccaatttttaagtttttctttttcatcgggaagattgaaagagaccttctgaatgtattaagaatgagaaaaagttacaagaaaaacataataggaagttgtcgaggatgatgcgcaccagcgtgtgcgttcaagaaccacgagctaaccacacaagcacaaacctctaaaagtgaaaacttcttcttagataatacttaattaatggattatttttctgtgcatggagggcacaaccttatactgctttctaaaatgggtatgataattatttgatagtataaacgaatgaatcaagtattacaaagtcgataagctgatttttttttaaaaaaaaactttataagtgcagttgtaacttttttttaaaaaaaatatcatatcatttgaaagcatatcggcaacattctattgtaacatgttactataagaacatcgttctaatttcgatacgatgaatgcagggaacacgaacacgctggcggggaacgtgccgccgaaggcgaacctgggggacctccgggggctcgcctcgggcctcgacggcgtgtcgagctccgccatgatcgacggcggcgagttcgacggcgccaaggcctacaaggacagcaaggtgtgcaacatgctgacgatgcaggagttccaccgccggtaccacggcgagaccggggtgacgttcgcgtcgctctaccccgggtgcatcgccaccacgggcctcttccgggagcacgtcccgctgttccgcctcctcttcccgcccttccagaagtacatcaccaagggctacgtctccgaggaggaggccggcaagcggctggcccaggtcgtcagtgaccccagcctcaccaagtccggggtgtactggagctggaacaacaactcggcctcgttcgagaaccagctctccgaggaggcctccgatccggagaaggccaagaaggtctgggagctcagcgagaagctcgtcggcttggccgatcacgatcagtgagtgagagtgatgtgctattgattttcgtctaggattttgctgtgctcttcttcttcttctcctctctaccaagaaagatcgatggaggagaatttgtaggacgcgtttctcacgaattacttagctgttaatgatcagcttgatgtgtacgatatgatggtgcagagtgaaagttgtgttgttcactggtggatcatgggatgggaatatgggattgttgtaagatgtaactcaagtgttttcttttttgggattacttttggtaataagagcttgggtgatcgaaaactacagatggtttttcttttaagttgtatgatctctgtagagtttttgagtaatttgtagttttgtaccctatcaaagatcatctctagctgcctctgagctctccaactctatatgtccatctctagtatatatgtcccatatttctgactgaaaattttcaagtcggttggttc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0496900, RefSeq:Os10g0496900