Os04g0509600

From RiceWiki
Revision as of 02:36, 10 June 2014 by Remedychen (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsAMT1;1(Os04g0509600)is one of the OsAMT1 family members which contain three genes(OsAMT1;1,OsAMT1;2 and OsAMT1;3).OsAMT1;1 has ammonium transporters activity.The amino acid sequences of the OsAMT1;1, OsAMT1;2 and OsAMT1;3 share high sequence similarity to each other and to other AMT1-type ammonium transporters previously identified from other plant species[1].All three isolated OsAMT1 genes encode functional ammonium transporters.OsAMT1;1 responds to ammonium in a comparable time and concentration-dependent manner,although absolute changes in transcript accumulation were less pronounced.The first step in nitrogen assimilation by plants is the uptake of the nitrate and ammonium into root cells from the soil solution. Since all three isolated transporter genes werefunctional in yeast, their translation products are thought to primarily contribute to the uptake of ammonium into the root.Because exclusive supply of ammonium is harmful, the ammonium taken up by the OsAMT1s is probably assimilated into glutamine through the reaction catalyzed by glutamine synthetase (GS) via glutamate through the reaction by glutamate synthase (GOGAT), designated as the concerted GS/GOGAT cycle[2].

Expression

OsAMT1;1 expression was constitutive in shoots and promoted by ammonium in roots;OsAMT1;2 expression was root specific and ammonium inducible,while OsAMT1;3 was also expressed specifically in roots but was repressed by nitrogen. These results implied feedback regulation, i.e. positive and negative control mechanisms for AMT1 genes in rice.It has been suggested that the cellular nitrogen status controls nitrogen and carbon metabolism as well as nitrogen absorption in roots[1][3].

Evolution

  Diversity and selective sweep in the OsAMT1;1 genomic region of rice.
  Effects of the fungal endophyte Phomopsis liquidambari on nitrogen uptake and metabolism in rice.
  Influence of different nitrogen inputs on the members of ammonium transporter and glutamine synthetase genes in two rice genotypes having differential responsiveness to nitrogen.
  AMT1;1 transgenic rice plants with enhanced NH4+ permeability show superior growth and higher yield under optimal and suboptimal NH4+ conditions.

Labs working on this gene

Please input related labs here.

References

[1] [3] [2]

Structured Information

Gene Name

Os04g0509600

Description

Similar to Ammonium transporter Amt1

Version

NM_001059815.1 GI:115459359 GeneID:4336365

Length

2043 bp

Definition

Oryza sativa Japonica Group Os04g0509600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

{{{Chromosome}}}

Location

Chromosome 4:25899053..25901095

Sequence Coding Region

25899136..25900632

Expression

GEO Profiles:Os04g0509600

Genome Context

<gbrowseImage1> name=NC_008397:25899053..25901095 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:25899053..25901095 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgacgtgcgcggcggacctggcgccgctgctggggccggtggcggcgaacgcgacggactacctgtgcaaccggttcgccgacacgacgtcggcggtggacgcgacgtacctgctcttctcggcgtacctcgtgttcgccatgcagctcgggttcgcgatgctctgcgccgggtcggtgcgggccaagaacacgatgaacatcatgctcaccaacgtgctcgacgccgcggccggggcgctcttctactacctcttcggcttcgccttcgccttcggcacgccgtccaacggcttcatcgggaagcagttcttcggcctcaagcacatgccgcagaccgggttcgactacgacttcttcctcttccagtgggccttcgccatcgccgccgccgggatcacgtcgggctccatcgccgagaggacgcagttcgtcgcctacctcatctactccgccttcctcaccgggttcgtctacccggtggtgtcccactggatctggtccgccgatgggtgggcctctgcctcccgcacgtccggacctctgctgttcggctccggtgtcatcgacttcgccggctccggcgtcgtccacatggtcggcggtgtcgccgggctctggggcgcgctcatcgagggcccccgcatcgggaggttcgaccacgccggccgatcggtggcgctcaagggccacagcgcgtcgctcgtcgtgcttggcaccttcctgctgtggttcggctggtacggattcaaccccgggtcgttcaccaccatcctcaagacgtacggcccggccggcggcatcaacgggcagtggtccggagtcggccgcaccgccgtgacgacgaccctggccggcagcgtggcggcgctcaccacgctgttcgggaagcggctccagacggggcactggaacgtggtcgacgtctgcaacggcctcctcggcgggttcgccgccatcaccgccgggtgcagcgtcgtcgacccgtgggccgcgatcatctgcgggttcgtctcggcgtgggtgctcatcggcctcaacgcgctcgccgcgcgcctcaagttcgacgacccgctcgaggccgcccagctccacggcgggtgcggcgcgtgggggatcctcttcaccgcgctcttcgcgaggcagaagtacgtcgaggagatctacggcgccggccggccgtacggcctgttcatgggcggcggcggcaagctgctcgccgcgcacgtcatccagatcctggtcatcttcgggtgggtcagctgcaccatgggacctctcttctacgggctcaagaagctcggcctgctccgcatctccgccgaggacgagacgtccggcatggacctgacacggcacggcgggttcgcgtacgtctaccacgacgaggacgagcacgacaagtctggggttggtgggttcatgctccggtccgcgcagacccgcgtcgagccggcggcggcggctgcctccaacagcaacaaccaagtgtaa</cdnaseq>

Protein Sequence

<aaseq>MATCAADLAPLLGPVAANATDYLCNRFADTTSAVDATYLLFSAY LVFAMQLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGALFYYLFGFAFAFGTPSNGFIG KQFFGLKHMPQTGFDYDFFLFQWAFAIAAAGITSGSIAERTQFVAYLIYSAFLTGFVY PVVSHWIWSADGWASASRTSGPLLFGSGVIDFAGSGVVHMVGGVAGLWGALIEGPRIG RFDHAGRSVALKGHSASLVVLGTFLLWFGWYGFNPGSFTTILKTYGPAGGINGQWSGV GRTAVTTTLAGSVAALTTLFGKRLQTGHWNVVDVCNGLLGGFAAITAGCSVVDPWAAI ICGFVSAWVLIGLNALAARLKFDDPLEAAQLHGGCGAWGILFTALFARQKYVEEIYGA GRPYGLFMGGGGKLLAAHVIQILVIFGWVSCTMGPLFYGLKKLGLLRISAEDETSGMD LTRHGGFAYVYHDEDEHDKSGVGGFMLRSAQTRVEPAAAAASNSNNQV</aaseq>

Gene Sequence

<dnaseqindica>84..1580#acgcccaatcctgccgccgtttcagcagctctagtttgaacgagggatcgtagagaggagggtttggtgagggagggaggaagatggcgacgtgcgcggcggacctggcgccgctgctggggccggtggcggcgaacgcgacggactacctgtgcaaccggttcgccgacacgacgtcggcggtggacgcgacgtacctgctcttctcggcgtacctcgtgttcgccatgcagctcgggttcgcgatgctctgcgccgggtcggtgcgggccaagaacacgatgaacatcatgctcaccaacgtgctcgacgccgcggccggggcgctcttctactacctcttcggcttcgccttcgccttcggcacgccgtccaacggcttcatcgggaagcagttcttcggcctcaagcacatgccgcagaccgggttcgactacgacttcttcctcttccagtgggccttcgccatcgccgccgccgggatcacgtcgggctccatcgccgagaggacgcagttcgtcgcctacctcatctactccgccttcctcaccgggttcgtctacccggtggtgtcccactggatctggtccgccgatgggtgggcctctgcctcccgcacgtccggacctctgctgttcggctccggtgtcatcgacttcgccggctccggcgtcgtccacatggtcggcggtgtcgccgggctctggggcgcgctcatcgagggcccccgcatcgggaggttcgaccacgccggccgatcggtggcgctcaagggccacagcgcgtcgctcgtcgtgcttggcaccttcctgctgtggttcggctggtacggattcaaccccgggtcgttcaccaccatcctcaagacgtacggcccggccggcggcatcaacgggcagtggtccggagtcggccgcaccgccgtgacgacgaccctggccggcagcgtggcggcgctcaccacgctgttcgggaagcggctccagacggggcactggaacgtggtcgacgtctgcaacggcctcctcggcgggttcgccgccatcaccgccgggtgcagcgtcgtcgacccgtgggccgcgatcatctgcgggttcgtctcggcgtgggtgctcatcggcctcaacgcgctcgccgcgcgcctcaagttcgacgacccgctcgaggccgcccagctccacggcgggtgcggcgcgtgggggatcctcttcaccgcgctcttcgcgaggcagaagtacgtcgaggagatctacggcgccggccggccgtacggcctgttcatgggcggcggcggcaagctgctcgccgcgcacgtcatccagatcctggtcatcttcgggtgggtcagctgcaccatgggacctctcttctacgggctcaagaagctcggcctgctccgcatctccgccgaggacgagacgtccggcatggacctgacacggcacggcgggttcgcgtacgtctaccacgacgaggacgagcacgacaagtctggggttggtgggttcatgctccggtccgcgcagacccgcgtcgagccggcggcggcggctgcctccaacagcaacaaccaagtgtaaccaatccagaacgaacgacgtcacagcgaaggaagaaatcacgggtttctctccctctccgatctcgatcgtcacgtcataaatttgatccccatatttgattgccagtttctgtttgggccaaatgcttttgccgctctctctggtgttgcaagactgtaaaaacactgtaggatggacgagtgtctttcacttttgctgggcttctcttgtgtacaggcatgcgtacgtgtcttagaatgtgtggtgtgaaggtgggaagaatcagaggttagggtttaattttcttttgcacaatggttactgctattattgttttattttgtggtcgaattttatcgtcataagggtgtggtggaatggtggtcaagataggtggctgtgcagggctcaaagactttgcgtgggtccttttgtcctgcagtgctctacctctctatcaaaactttggcttatttcctgg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0509600, RefSeq:Os04g0509600

  1. 1.0 1.1 1.2 Sonoda Y, Ikeda A, Yamaya T, et al. Feedback regulation of the ammonium transporter gene family AMT1 by glutamine in rice[C]//Plant and Cell Physiology. GREAT CLARENDON ST, OXFORD OX2 6DP, ENGLAND: OXFORD UNIV PRESS, 2004, 45: S98-S98.
  2. 2.0 2.1 Suenaga A, Moriya K, Sonoda Y, et al. Constitutive expression of a novel-type ammonium transporter OsAMT2 in rice plants[J]. Plant and Cell Physiology, 2003, 44(2): 206-211.
  3. 3.0 3.1 Sonoda Y, Ikeda A, Saiki S, et al. Distinct expression and function of three ammonium transporter genes (OsAMT1; 1–1; 3) in rice[J]. Plant and Cell Physiology, 2003, 44(7): 726-734.