Os04g0682000

From RiceWiki
Revision as of 03:00, 10 June 2014 by Xiaoshui (talk | contribs) (Annotated Information)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

It has found that OsATG8 interacts with OsATG4, which functions as cysteine protease to cleave the C-terminal region of OsATG8(1).

OsAtg4 shows low similarity to yeast and Arabidopsis Atg4, but the Cys-164,Asp-361 and His-361 of OsAtg4 are strictly conserved in all homologues(1), which constitute the conserved geometry observed in the canonical catalytic triad of cysteine protease(2). As shown in Figure B, sequence comparison of OsAtg4 (ABB77259) and its Arabidopsis (BAB88384, 56% identity), yeast (P53867, 26% identity) homologues. Identical residues are shaded in black, similarity residues are shaded in gray. The conserved residues are boxed(1).

As showed in Fig. 5, Atg4 interacts with Atg8 and its mutants, indicating the conserved Gly117 mutation does not affect this interaction. This cleavage reaction may include two-step mechanism involving the recognition of the OsAtg8 core and the subsequent recognition of the OsAtg8 tail by OsAtg4. The tail region of OsAtg8 is crucial for hydrolysis, but it is not indispensable to the interaction between the core region of OsAtg8 and OsAtg4(1).

In addition to Atg8 lipidation, the deconjugation of Atg8 by Atg4 is also essential for autophagosome formation(3).In addition to ATG8s, When focus on Atg4 homologs, which may function in the C-terminal cleavage of ATG8s required for their modification and in the deconjugation of their modified forms. Two homologs of the ATG4 gene, ATG4a and 4b, were identified in the Arabidopsis genome (4).


FF figure1.png FF figure3.png FF figure5.png FF figureB.png

Expression

ATG4 proteins had a significant but low level of identity with the yeast Atg4 protein (ATG4a-yeast Atg4, 26%; ATG4b-yeast Atg4, 29%). However, the two ATG4s displayed 71% overall amino acid identity(5).As shown in Figure 1C, the two ATG4s were ubiquitously expressed like ATG8s(5).

As showed in Fig 3, OsAtg8 and OsAtg4 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice(1).

Proteinase ATG4 has several conservative cysteine residues in its structure, and can therefore serve as a redox sensor(6).


Evolution

Labs working on this gene

(1)Institute of Genetics, State Key Laboratory of Genetic Engineering, School of Life Sciences, Fudan University

(2)Kazusa DNA Research Institute, Kisarazu, Chiba 292-0812, Japan

(3)Department of Cell Biology, National Institute for Basic Biology, Myodaijicho, Okazaki 444-8585, Japan

(4)Key Laboratory of Bio-resources & Eco-environment (Ministry of Education), College of Life Science, Sichuan University,Chengdu 610064, China

References

1. Su W, Ma H, Liu C, et al. Identification and characterization of two rice autophagy associated genes, OsAtg8 and OsAtg4[J]. Molecular biology reports, 2006, 33(4): 273-278.

2. Mariño G, Urı́a J A, Puente X S, et al. Human autophagins, a family of cysteine proteinases potentially implicated in cell degradation by autophagy[J]. Journal of Biological Chemistry, 2003, 278(6): 3671-3678.

3. Kirisako T, Ichimura Y, Okada H, et al. The reversible modification regulates the membrane-binding state of Apg8/Aut7 essential for autophagy and the cytoplasm to vacuole targeting pathway[J]. The Journal of cell biology, 2000, 151(2): 263-276.

4. Hanaoka H, Noda T, Shirano Y, et al. Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene[J]. Plant Physiology, 2002, 129(3): 1181-1193.

5. Yoshimoto K, Hanaoka H, Sato S, et al. Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for plant autophagy[J]. The Plant Cell Online, 2004, 16(11): 2967-2983.

6. Minibayeva F, Dmitrieva S, Ponomareva A, et al. Oxidative stress-induced autophagy in plants: The role of mitochondria[J]. Plant Physiology and Biochemistry, 2012, 59: 11-19.

Structured Information

Gene Name

Os04g0682000

Description

Similar to Autophagy 4a

Version

NM_001060828.1 GI:115461385 GeneID:4337435

Length

3422 bp

Definition

Oryza sativa Japonica Group Os04g0682000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:35216531..35219952

Sequence Coding Region

35216815..35217023,35217115..35217185,35217292..35217347,35217776..35217914,35218039..35218424
,35218530..35218580,35218665..35218750,35218841..35219279

Expression

GEO Profiles:Os04g0682000

Genome Context

<gbrowseImage1> name=NC_008397:35216531..35219952 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:35216531..35219952 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacgagcttgcctgataggggtgtatcatcgtcttcatctgatccgttgtgcgagggtaacattgcaccttgttcttctagctcggaacagaaggaggattgtagcctgaaacaatcgaaaacctcgatcctgtcctgcgttttcaattcacctttcaatatctttgaggcgcaccaggattcgtccgcaaacaagtcgccgaaatcgtcctctggatcctatgattggtcgagggtattgaggaggatcgtgtgctctggctcaatgtggcgttttctgggcacctccaaggttctcacttcaagtgatgtgtggttccttggtaaatgttacaagctttcgtcggaggagtcgtctagtgactcagattccgaaagtgggcatgccacatttcttgaggacttctcgtcaaggatatggatcacttatcgcagaggctttgatgccatctctgattccaagtatactagtgatgtgaactggggctgcatggtcagaagcagccagatgctggttgctcaggcattgattttccaccatcttggcagatcttggagaaggcccttggagaagccatataacccagaatatatagggatcttacacatgtttggtgattctgaagcttgtgctttctcaattcacaatttacttcaagctggaaatagttatggtctggctgctggatcatgggtgggtccatacgccatgtgtcgggcatggcaaacccttgtccgcaccaatagggagcaacatgaagttgttgatgggaatgaaagtttccctatggctctttatgtggtatccggtgatgaagatggtgaaagaggtggagctccagttgtttgtattgatgttgctgctcagctttgctgtgatttcaacaaaggtcaatcaacttggtcaccgattcttttgctggtccctctggttcttggtcttgacaaaattaatccaaggtacattcctttactaaaggagacgttcacatttcctcagagcttggggattttgggtggaaagcctggaacatcaacctacattgctggggtacaggatgacagggcgctctacctagatccccatgaagttcagatggcagttgatattgcagctgataacatagaggcagacacttcttcataccactgcagcactgtacgagatttggccctagacctgatagatccgtcattggctattggtttttactgccgtgataaagatgacttcgatgatttctgttctcgcgccactgagctagtagataaagccaatggagcaccactcttcactgttgtgcagtcggttcaaccgtcaaaacaaatgtacaatcaggacgatgtgttgggcatctcaggggatggcaacatcaatgtcgaggacctcgatgcctcaggtgaaacaggagaggaggaatggcagattctttag</cdnaseq>

Protein Sequence

<aaseq>MTSLPDRGVSSSSSDPLCEGNIAPCSSSSEQKEDCSLKQSKTSI LSCVFNSPFNIFEAHQDSSANKSPKSSSGSYDWSRVLRRIVCSGSMWRFLGTSKVLTS SDVWFLGKCYKLSSEESSSDSDSESGHATFLEDFSSRIWITYRRGFDAISDSKYTSDV NWGCMVRSSQMLVAQALIFHHLGRSWRRPLEKPYNPEYIGILHMFGDSEACAFSIHNL LQAGNSYGLAAGSWVGPYAMCRAWQTLVRTNREQHEVVDGNESFPMALYVVSGDEDGE RGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKINPRYIPLLKETFTFPQ SLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMAVDIAADNIEADTSSYHCSTVRDLA LDLIDPSLAIGFYCRDKDDFDDFCSRATELVDKANGAPLFTVVQSVQPSKQMYNQDDV LGISGDGNINVEDLDASGETGEEEWQIL</aaseq>

Gene Sequence

<dnaseqindica>2930..3138#2768..2838#2606..2661#2039..2177#1529..1914#1373..1423#1203..1288#674..1112#cgcgattcgccgtctccatctcgtctcccgcttcctccccgcgtccgccacgccaccccccacctcgccgcctcgccgtggctgctcctcccctcccctcccctccccgccgccggtgctccggccttcgctgccgccgtgctttctctatctatcctcttcccccacgcggacgggggtgcggcgattcgggctctccgccggacacgcgtcgcttcggcctcaactgaagagccacgcttcggtctcgactctcgaacccccaaggtattcctctcccccaagccttccttcgccgcaccgcctgcgtggagtaaaactgcagagatccatctggaattgggctgtgttcttttgttggtgatggactctcttagcttgcttgattgggttgtgttcggagttttgttctagtctgtttcacttttgctgtggctaatctaatccgcatatttctttctctgcaatgaatgaataaatgtaataattggcccatccagtttgttgcgttgcagaagattcgtttgatgcgtgctgaagtacaatcgtgaaaggaaggaactgtgccaacaccacctgattggtactcctgtcgttcttggacaggagattgattttgcttcggtaggagacccaattgcggatggaatatgcacacgtgcgttgttaggtaatgacgagcttgcctgataggggtgtatcatcgtcttcatctgatccgttgtgcgagggtaacattgcaccttgttcttctagctcggaacagaaggaggattgtagcctgaaacaatcgaaaacctcgatcctgtcctgcgttttcaattcacctttcaatatctttgaggcgcaccaggattcgtccgcaaacaagtcgccgaaatcgtcctctggatcctatgattggtcgagggtattgaggaggatcgtgtgctctggctcaatgtggcgttttctgggcacctccaaggttctcacttcaagtgatgtgtggttccttggtaaatgttacaagctttcgtcggaggagtcgtctagtgactcagattccgaaagtgggcatgccacatttcttgaggacttctcgtcaaggatatggatcacttatcgcagaggtaggtttgtttacacgaccatatgcctggtacagcatgttaatgtgtggaaatcagttgtgagttgtttgcactgtctttttgttgcaggctttgatgccatctctgattccaagtatactagtgatgtgaactggggctgcatggtcagaagcagccagatgctggttgctcaggtgcttgtcgactttatttgattgaaataacagcattttttttaccactgcatttgtaaaatgtacttggatggatttttgcaggcattgattttccaccatcttggcagatcttggagaaggcccttggagaaggtgagatacatgactacctgctgatcttaagacaatgaaaattttcttttttcagttgtagtaggtgatgggcctcttttacaatgatcaaatgttcatatgcagccatataacccagaatatatagggatcttacacatgtttggtgattctgaagcttgtgctttctcaattcacaatttacttcaagctggaaatagttatggtctggctgctggatcatgggtgggtccatacgccatgtgtcgggcatggcaaacccttgtccgcaccaatagggagcaacatgaagttgttgatgggaatgaaagtttccctatggctctttatgtggtatccggtgatgaagatggtgaaagaggtggagctccagttgtttgtattgatgttgctgctcagctttgctgtgatttcaacaaaggtcaatcaacttggtcaccgattcttttgctggtccctctggttcttggtcttgacaaaattaatccaaggtaagcagcaagctattaaatctcattctttgtaggcttcatatggtcacccttgaacggttgatgtttctactgatggttgtttctagtattaatcacttcctgccattgcccttactatcaggtacattcctttactaaaggagacgttcacatttcctcagagcttggggattttgggtggaaagcctggaacatcaacctacattgctggggtacaggatgacagggcgctctacctagatccccatgaagttcagatggtaaaactgcattatttacttagcatatatgagcgccaattttatagatgtgtttttctatctgcaatctggtcaataagtaaaactttcatatgtagtaggttgtaatttagaatcttgatttcatcaatgtgataagtaattcatgcctttttaatggtgccctgtcctcccattcacaacaatggcaacacaaaaaaacagcaaagcggtatattagtgttcgcctttgtctattatgcatgcagtcagcgaccgttattatctggctatttttgcagtatccctttttgcttggaatccattttggttagtaaccttgtagaagtagatggattttgtatttatcaatgtaatgactagggagctatttttgtttttcatttttgagctatggtagttacagtggggtgttctctacatctcaggcagttgatattgcagctgataacatagaggcagacacttcttcataccactgcaggtatgttcgcaattgcagttatgatttggtaaatggtacctaatattcgttatccttttaatttttcaataatgaaaaaacttattatctagctgcactttgacagcactgtacgagatttggccctagacctgatagatccgtcattggctattggtttttactgccgtgataaaggtgaactgtgattgtcgaacaaatgtcgcgtcatcattttaagttcactctaatcttggttttcttatttactgtctgcctgcttatgtagatgacttcgatgatttctgttctcgcgccactgagctagtagataaagccaatggagcaccactcttcactgttgtgcagtcggttcaaccgtcaaaacaaatgtacaatcaggacgatgtgttgggcatctcaggggatggcaacatcaatgtcgaggacctcgatgcctcaggtgaaacaggagaggaggaatggcagattctttagtgaaggaacaaaactgacctcatgaggtacagaaaacgttgcgtccaacacgtcggtcgaatgcccttgtttatgtgtgggtgaatagaaatgactcgttgtgttgtctacagaacaagctggcactgtctcgataccccagggggttgggtcttgggagaatcagctttaggtgctaccgatgtaaaaatgtgatcagttcatcgctcattcgttggaaatctccttgtatcatacatgctcttgtggttggctataactcaaaatttattatacgttctgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0682000, RefSeq:Os04g0682000