Os09g0106700

From RiceWiki
Revision as of 03:21, 10 June 2014 by Wbaochengll (talk | contribs) (Labs working on this gene)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

  • PutAKT1 is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii)in P. tenuiflora , even under saltstress condition.The notion that AKT1-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of AKT1-disrupted mutants.
  • PutAKT1 not only increases tissue K+ accumulation, but also decreases Na+.

Expression

  • The AKT1 is preferentially expressed in peripheral root cell layers and root hairs.
  • Expression of PutAKT1 increased the K+ content under normal K+ -starvation,and NaCl-stress conditions.
  • The expression of PutAKT1 was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing PutAKT1 showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight.
  • Expression of PutAKT1 also showed a decrease in Na+ accumulation both in the shoot and in the root.

Expression in experiment

Subjected to NaCl and K+-starvation stresses for 24 h, PutAKT1 was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, PutAKT1 expression was monitored over a 24-h period.

  • In rice, the expression

level of PutAKT1 is down-regulated by excessive external NaCl. Under K+-starvation stress, PutAKT1 was dramatically induced at 24 h of stress.

Evolution

PutAKT1 belongs to the AKT1-subfamily in the Shaker K+ channel family. PutAKT1 was localized in the plasma membrane and it was preferentially expressed in the roots.there are three AKT1-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that PutAKT1 belongs to a small gene family.

Labs working on this gene

  • Asian Natural Environmental Science Center (ANESC),The University of Tokyo, 1-1-1 Midori-Cho, Nishitokyo,Tokyo 188-0002, Japan
  • Department of Agronomy and Horticulture,Bogor Agricultural University (IPB), Jl. Meranti, Kampus IPB, Darmaga Bogor 16680, Indonesia S. Liu
  • Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin 150040, China

References

Please input cited references here.

Structured Information

Gene Name

Os09g0106700

Description

Similar to Myb proto-oncogene protein (C-myb)

Version

NM_001069097.1 GI:115477933 GeneID:4346379

Length

1586 bp

Definition

Oryza sativa Japonica Group Os09g0106700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:603500..605085

Sequence Coding Region

604001..604960

Expression

GEO Profiles:Os09g0106700

Genome Context

<gbrowseImage1> name=NC_008402:603500..605085 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:603500..605085 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaa</cdnaseq>

Protein Sequence

<aaseq>MMASCRRGGGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLIS KSIPGRSGKSCRLRWCNQLSPQVEHRPFTPEEDDTILRAHARFGNKWATIARLLAGRT DNAIKNHWNSTLKRKHHSSLLADDLRPLKRTTSDGHPTLSSAAAPGSPSGSDLSDSSH HSLPSQMPSSPPHLLLPQHVYRPVARAGGVVVPPPPPPPPPATSLSLSLSLPGLDHPH PDPSTPSEPAVQLQPPPPSQMPPPTPSCVRQEPPQMPFQLQPPPPPRPSAPFSAEFLA MMQEMIRIEVRNYMSGSAAVDPRSSPDNGVRAASRIMGMAKIE</aaseq>

Gene Sequence

<dnaseqindica>126..1085#ctgacttaatttagctccgcctccattcacgcattcacactagcatagcatataagatagcacttgtagagaggagatactagtacacatagagaagaggagaggagattgatcggtgagggaggatgatggcgtcttgtcggagaggagggggaggggatgtggataggataaaggggccgtggagtccggaggaggacgaggcgctgcagcggctggtggggcggcacggggcgcgcaactggtcgctgataagcaagtccatcccggggaggtcggggaagtcgtgccggctgcggtggtgcaaccagctgtcgccgcaggtggagcaccggcccttcactcccgaggaggacgacaccatcctccgcgcccacgcccgcttcggcaacaagtgggccaccatcgccaggctcctcgccggccgcaccgacaacgccatcaagaaccactggaactccaccctcaagcgcaagcaccactcttctctcctcgccgacgacctccgccctctcaagcggacaaccagcgacggccacccgacgctctcctccgccgccgcccccgggagcccctccggctccgacctcagcgactccagccaccatagcctcccctcccagatgccctcctcacccccacacctcctcctccctcagcacgtctaccgcccggtcgcgagggccggcggggtcgtcgtccctcctcctcctcccccgccgcctccggcgacctcgctctccctctctctctcccttcccggcctggatcacccacaccccgatccctccaccccgtcggagcctgcggtacagttgcagccgcctccaccgtctcagatgccgccaccaacaccatcttgtgtacgccaagagccgcctcagatgccgttccagctgcagcccccaccgccgccgcgcccatcggcgccgttcagcgcggagttcttggccatgatgcaggagatgatccggatcgaggtccggaattacatgtccggctccgccgccgtggatcctcggtcgtcgcccgacaacggcgtgcgcgccgccagccgcatcatgggcatggccaagatcgagtaatcaaccagccgcagcagcatacggaatgatcgagtaatcaagctcagattgatgcactgcaagcaagaaagcagagcaagaagcagaggcgccggcgcggcaagtgaagagacgacgaccatcaacgtttggatcctccttttctattctgctatagtcttcttcttccccaataattccttgtctagttttaatttttttttctcttcaatttttactcctccaatccaagttgaagttgtcactagtagagttctccagagagagaggagatgaagcaacaacaaggagctgtgtctgcctgtctggaggaactaataccaaaccaaaataagcagagtgtgtgctgctgtgccacaatcagcaccaccaccgtggcaccacccactagcttagcttagctagctagttcaaagttctttttgtatatacttataagaggaaaaagaaaaaagagagctgatcagtgaaaattcagaatgcatcagtgaagagaattgc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0106700, RefSeq:Os09g0106700