Os02g0552700

From RiceWiki
Revision as of 04:21, 10 June 2014 by Nigel9011 (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

This gene encodes a novel CCHC-type zinc finger pronein called OsZFP6. OsZFP6 is structurally and functionally conserved, mainly localised in nucleus, and can play an important role in stress tolerance responses to salt (NaCl), alkali (NaHCO3), and H2O2 treatment in rice. Functional analysis also showed overexpression of this gene in transgenic Arabidopsis and yeast to NaHCO3 and H2O2.

Construction

The OsZFP6 gene is a single-copy gene in the rice genome. It is 1559 bp in length with a 458 bp 5' UTR and a 186 bp 3' UTR. The ORF encodes a 304 amino acid with a molecular weight of 33.6 kDa and an isoelectric point of 7.35. Based on structural properties indicated by the SMART programs, the predicted protein contains two conserved domains: a Pfam retrotrans-gag domain from amino acid 48 to 146 and a ZnF C2HC domain from amino acid 216 to 232.

Expression

Using the online analysis tool Psort to predict the subcellular localisation of rice OsZFP6, OsZFP6 was localised to the nucleus with a 73.9% probability. To validate the predicted result, a PBI121-OsZFP6:GFP plasmid was transformed into onion epidermal cells. After culture for 18-24 h in the dark, green fluorescence was observed in the nucleus (as shown in figure), suggesting the OsZFP6 protein, driven by the 35S promoter, was localized in the nucleus. Tissue distribution of OsZFP6 gene expression is still unknown yet.

Evolution

The CysCysHisCys (CCHC)-type zinc finger domains contain the sequence C-X2-C-X4-H-X4-C, where X can be any amino acid, and the numbers indicate the number of residues. This domain is conserved in Arabidopsis, yeast and rice, as shown in table.

Labs working on this gene

Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin, Heilongjiang 150081, China.

References

Guan QJ, Wang LF, Bu QY, Wang ZY. (2014) The rice gene OsZFP6 functions in multiple stress tolerance responses in yeast and Arabidopsis. Plant Physiol Bioch 82: 1-8.

Structured Information

Gene Name

Os02g0552700

Description

Zinc finger, CCHC-type domain containing protein

Version

NM_001053643.1 GI:115446656 GeneID:4329640

Length

1559 bp

Definition

Oryza sativa Japonica Group Os02g0552700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:21704297..21705855

Sequence Coding Region

21704755..21705669

Expression

GEO Profiles:Os02g0552700

Genome Context

<gbrowseImage1> name=NC_008395:21704297..21705855 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:21704297..21705855 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcttttgaggtcgattggtcaagcatctcacctcacagatgatcctcctgatgagaaaacggatgcaactaaaattaaggcgtggaaaacagcagatgatcgtgttatgggattcatattcatgagtgtagaggtgcctattcggatgagtttcagggatcacactaccgctaaagagatgtgggactacctcaaacagaggtacactcaagaaagcggagctttgcgtttttccttgctgcagaatttgcacaacttacaacaacaagatcagtccattgaagaattttataatgcctttactcggttgtctggacagcttgaggcacagactccaaaaggtgcttcaggttgtgcacaatgcaaggcgagagagaagcatgatcaagaaaatctagtgtatcaatttgtcatgagactttcctctcaatttgagtccattcgagttcagttgcttggacgtcctacacgtcctactatggcggaggctcttgcagatctaatcgctgaggagacacgtctttgttccttggacactactcctactcctgtggttactcacaatgtcatggcagcacctcagcgtgttggagctcctatgggcgggatccctgaattcagttccatcgccaaaagtgatcgtatttgctctcattgcaagaaggttggacatatttccgatgattgcttctatcttcatccagagaagttggctgattatcaagctaggcgtgcagcggtcccccgtcctcgtgcgacggctagtgctcctgttttcttggatatcactgctgctggtccttctagtactagtgctggtggcagtgcctctagcgccgtctcatgtgctcctcagtcattggttgcaagaccgtcttatcaagccagtgattggtcatggccatcaccatag</cdnaseq>

Protein Sequence

<aaseq>MLLRSIGQASHLTDDPPDEKTDATKIKAWKTADDRVMGFIFMSV EVPIRMSFRDHTTAKEMWDYLKQRYTQESGALRFSLLQNLHNLQQQDQSIEEFYNAFT RLSGQLEAQTPKGASGCAQCKAREKHDQENLVYQFVMRLSSQFESIRVQLLGRPTRPT MAEALADLIAEETRLCSLDTTPTPVVTHNVMAAPQRVGAPMGGIPEFSSIAKSDRICS HCKKVGHISDDCFYLHPEKLADYQARRAAVPRPRATASAPVFLDITAAGPSSTSAGGS ASSAVSCAPQSLVARPSYQASDWSWPSP</aaseq>

Gene Sequence

<dnaseqindica>459..1373#atctatcactgtaagatggtatcagagctcatgggctgaaccctagccctcgatccccgttgtccgccggcgctccggcttgccggcggcggctccctatcgggcaaatcttcttcacgtcctcctcgtccggatcagcagcgggattcacagcaagtcagtgtgattcgtccgtcaagcgtgagtgcatcgctcattgcagccgctcgtcacgcggttgctccgctcagccgttgttgctgctcttccactactgctgccgctgtgtgctgctggtgctaattcaggagacaatacatcaagtcctgtaagcaagtctctgtccagtcaatttgtcaaattttcttctgctggtcttgatggcaacatccgacccctttcttggaggtggagctctgctctccacggacattaagctaaatggtcaaaattatcaagaatgagaactttcagctcgtatgcttttgaggtcgattggtcaagcatctcacctcacagatgatcctcctgatgagaaaacggatgcaactaaaattaaggcgtggaaaacagcagatgatcgtgttatgggattcatattcatgagtgtagaggtgcctattcggatgagtttcagggatcacactaccgctaaagagatgtgggactacctcaaacagaggtacactcaagaaagcggagctttgcgtttttccttgctgcagaatttgcacaacttacaacaacaagatcagtccattgaagaattttataatgcctttactcggttgtctggacagcttgaggcacagactccaaaaggtgcttcaggttgtgcacaatgcaaggcgagagagaagcatgatcaagaaaatctagtgtatcaatttgtcatgagactttcctctcaatttgagtccattcgagttcagttgcttggacgtcctacacgtcctactatggcggaggctcttgcagatctaatcgctgaggagacacgtctttgttccttggacactactcctactcctgtggttactcacaatgtcatggcagcacctcagcgtgttggagctcctatgggcgggatccctgaattcagttccatcgccaaaagtgatcgtatttgctctcattgcaagaaggttggacatatttccgatgattgcttctatcttcatccagagaagttggctgattatcaagctaggcgtgcagcggtcccccgtcctcgtgcgacggctagtgctcctgttttcttggatatcactgctgctggtccttctagtactagtgctggtggcagtgcctctagcgccgtctcatgtgctcctcagtcattggttgcaagaccgtcttatcaagccagtgattggtcatggccatcaccatagttggtccccaaggcctctaagtgtgaggtcatcttcgcctaccacttttgttgccatctcctacttgttgcttttgcttgctgtttggagaaaaaggttgttgctgctatagtatatatctgtccttcagttcagttcaagtcttctgttatccattaaatctatctaagtcaatttcatatcttc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0552700, RefSeq:Os02g0552700