Os02g0535400

From RiceWiki
Revision as of 10:30, 10 June 2014 by Nengpan Zhang (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

The gene locus Os02g0535400 is a gene called Os RAR1(NCBI Gene ID: 4329567) and this gene codes a protein called Cysteine and histidine-rich domain-containing protein RAR1( NCBI ACCESSION:Q6EPW7)[1]. RAR1 (for required for Mla12 resistance) is an important component of R gene–mediated disease resistance, which contains two zinc binding finger motifs termed CHORD-I and CHORD-II (Cys- and His-rich domains). In plants, RAR1 interacts directly with SGT1 (for suppressor of the G2 allele of skp1) and HSP90. The CHORD-I domain of RAR1 interacts directly with the N terminus of HSP90, and SGT1 binds the CHORD-II domain of RAR1. SGT1 is required for disease resistance mediated by diverse R proteins and is also required for the function of an SCF (for Skp1/Cullin/F-box protein). RAR1, SGT1, and HSP90 were shown to play an important role in regulating the stability of R proteins that contain the NBS-LRR domain[1]. RAR1 is an important component in innate immunity in Rice. RAR1 is required for basal resistance against compatible races of rice blast and bacterial blight and this resistance is mediated by Os Rac1. Interestingly, Os RAR1is not required by the three examined riceRgenes for blast resistance. Recently, it was shown that OsRAR1is not required for Pish-mediated blast resistance[2]. RAR1 is critical for Os Rac1–mediated enhancement of PAMP signaling. Therefore, RAR1 activity in rice innate immunity may be on a broader scale than in those other species.

Expression

PCR reactions were performed with specific primer sets: Os RAR1(5'-TGCAAAACTGGAAAGCACAC-3' and 5'-GGAACTGCAGGCTTCTCAAC-3')[1].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. 1.0 1.1 1.2 Thao NP, Chen L, Nakashima A, Hara S, Umemura K, Takahashi A, Shirasu K, Kawasaki T, Shimamoto K.RAR1 and HSP90 form a complex with Rac/Rop GTPase and function in innate-immune responses in rice.Plant Cell. 2007 Dec;19(12):4035-45.
  2. Takahashi, A., Agrawal, G.K., Yamazaki, M., Onosato, K., Miyao, A., Kawasaki, T., Shimamoto, K., and Hirochika, H. (2007). Rice Pti1a negatively regulates RAR1-dependent defense responses. Plant Cell 9: 2940–2951.

Structured Information

Gene Name

Os02g0535400

Description

Conserved hypothetical protein

Version

NM_001053574.1 GI:115446518 GeneID:4329567

Length

2767 bp

Definition

Oryza sativa Japonica Group Os02g0535400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:20584982..20587748

Sequence Coding Region

20586274..20586295,20587512..20587747

Expression

GEO Profiles:Os02g0535400

Genome Context

<gbrowseImage1> name=NC_008395:20584982..20587748 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:20584982..20587748 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gtagagactagagaggccacaggcggcggcggcagcagcggaagtctctcgtctcgtccgtggagaaagggggaagacgaagatgtcgacggaggcggagaccaccagcgccgccgcccccgcccccgcccccgcccccgcatcggcgccggcgcggtgccagcggataggctgcgacgccacgttcaccgacgacaacaaccccgacggctcctgccaataccacccctccgtgacctatgtttcatgatggcatga</cdnaseq>

Protein Sequence

<aaseq>VETREATGGGGSSGSLSSRPWRKGEDEDVDGGGDHQRRRPRPRP RPRIGAGAVPADRLRRHVHRRQQPRRLLPIPPLRDLCFMMA</aaseq>

Gene Sequence

<dnaseqindica>1454..1475#2..237#agtagagactagagaggccacaggcggcggcggcagcagcggaagtctctcgtctcgtccgtggagaaagggggaagacgaagatgtcgacggaggcggagaccaccagcgccgccgcccccgcccccgcccccgcccccgcatcggcgccggcgcggtgccagcggataggctgcgacgccacgttcaccgacgacaacaaccccgacggctcctgccaataccacccctccgtgagtcctcctcctccccttcttccccttctaaatctcatggggtctaactaattgccccgcggattacgggagtggaggagtctgttcttctagggggaagttgggcagttcgaatctgtaatggcggggtcaagggcttcgcctgctcttgggaaacttctggggacgaattgggcagcggggaatatttgagttctatatacaataatgaaatttagtgtcatatagagatatgttggactacactcattactcatagtagattagtggattggattgcacgattatactcatagtagattagtagattagtggattggattacacgattcaatcagaagggttattgatgccattggcaaaaggtattgtagttgtcgcaaacacgtgatattaggtggttttttttttgccccttatttgggttaggatattggtaccttgaagctgcctcttgatgaggcatcatgggcaatgtgtctgatgtgtggcgagggatttttttcccctttggatatggctcacatgagtgctgactatttacaaaaagcaaaaggaaaagaggcaaagaactacctttcccttcagagagtaaacaaaattaatttggaataaagatatgacattctctttctctttctctttttcaatccctaccgtgtctaagggtcagatacccatgttgtaccaaaaaaggattaagtacacaaacagctgctgcaaaacttcttcacaacttcttctatttccaattgtgaatatctcttgataacaatggaagaaataatggttaattttttcaagcaattcttttcttttgtctccaaagattcaaatcacattgctaactttgtgatgccatgccaaattccattgtaatatttaaacaccaaattcacactcatgtttactgcatttggtctagaagaaatacacaacagctagtataagagaatacctaaatgtggtcccattcttttttggaaaatgacgaataaagcaacatatttaaacaagactcgtataatatgtttgctaactctctttatggtttcttgtctactgccaaatactatatttatttccaattttccactgtagtgttctgaccactgtctccttttttttttcttgcagggagtaagtgtttcttctttgcatgagagggtacttctagaaggatgcataggttaattttctaagattttttttttcagcctatgtttcatgatggcatgaaacagtggagttgctgtaagcaaaaaagccatgattttagcctatttttggctattcctgggtaaggatccctctctagtatttccttttcacagcatgcacccacaacataagtcaactatgtgctatcaacctgaacattaccatctgggctggcctgttgtgtattttagcaaaaccaagcatgaatgcatgaatcgtatgctgtactgctgtgtaggtgcaaaactggaaagcacacaactgagaaaccaatcacaaaagcagttcctactaaaccatcaaaggcagttccagtccagacttcgaagcagagtgtgggagctgacacttgctcaaggtgccgtcaaggtttcttttgctctgaccatggtgagtttctgtctataagcataatgcttggatacaactgattgatcccctatttgggtgtaacagctgattgtttcgttattattttaacgactgacatccctatgcatttttatgtgttgatagaataaatcgtaacttttaatttaacagattatgcactgctattttttcaggatcacaacccaaggcacaaataccaaccgctaccagtgatactaacatggtacctgttgagaagcctgcagttccaccaccaaagaaaaaaattgatctgaatgagcctagggtttgtaagaacaaaggatgtggtaaaacctacaaggagaaggataatcatgatgaagcatgcgattaccatccaggacctgcagtttttcgcgacaggattagaggggtatgtttttggttcaaacttattgttgttttgctctattccttgatttttgccatcactgactctgacatctttttaaaaatttttgcagtggaaatgttgtgatattcatgtcaaggaatttgatgaatttatggagatccctccgtgcacaaagggttggcacaatgctgatgccgcatgaattttcaccatgccccatcttggaataagaaccctattagcataaggttctcttgtatctcgtagtgcataaggtgcaatttttatggagaattttacttggagttggggagtgtggcaaagataccgagaataggctgttttaccgtgctctgtgtgactgctgcaaaagtgtgcgtggtgtttcattttttgtctgaaacggggacttgaaattgtgtgtggagacttcggtctcgttcgttggctcgttgccaattcttcatagttagaaaatcaaatgctccatctaaatgctatcctgcagacttttggtaacacccatctttctgtttatatg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0535400, RefSeq:Os02g0535400