Os09g0470500
Please input one-sentence summary here.
Contents
Annotated Information
Function
Oshox4 belongs to the homeodomain leucine zipper (HD-Zip) genes that encode transcription factors that contain conserved DNA motif called the homeobox[1]. There are four family members in HD-Zip including I, I, II, III and IV [2], and Oshox4 which locates in chromosome 9 belongs to HD-Zip I. In addition, it is suggested that all HD-Zip I and II proteins family members can form homodimers and also heterodimers[3].
Expression
Oshox4 expresses in leaf primordial of shoot apex, and in young leaves without polar distribution, even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA. Oshox4 expresses more in drought resistant than in drought-sensitive rice cultivars [1].
Evolution
Please input evolution information here.
Subcellular localization
To understand the subcellular localization of Oshox4, researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells [4](Fig. 2B).Mutant
When Oshox4 is over expressed in more than 40 independent transgenic T0 plants, there are 27 semi-dwarf phenotype plants that possess only a half of the wild ones as well as two times tillers than the normal wild plants (Fig. 3A).
This may due to the reduced transgenic plants cell elongation that occurs in epidermal, elongating and intercalary meristem cells compared to wild type. And Oshox4 may interact with the fragment corresponding to -1080 to-1662 from the initiation ATG codon of the YAB1. Further experiments show that these Oshox4-over-expression plants with semi-dwarf cannot be rescued by adding GA3 (Fig 5), but the mutant plants with semi-dwarf caused by YAB1-over-expression can rehabilitate to the same height of the wild type [5].
In Oshox4 over expressed mutants, both the GA metabolic gene expression and the amylase production change. At the same time, the GA upregulate the expression level of Oshox4[4]. Oshox4 knock-down plants by the expression of RNAi vector with a gene-specific segmet of Oshox4 show no significant changes, which may due to the function of other HD-Zip I in rice [4].
Considering the previous reports about Arabidopsis[6] and gibberellin biosynthesis [7] and other evidences, it is predicted that Oshox4 function in GA signaling.
Labs working on this gene
Please input related labs here.
References
- ↑ 1.0 1.1 Adamantia Agalou, Sigit Purwantomo, Elin O¨verna¨s et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members Plant Mol Biol (2008) 66:87–103.
- ↑ Sessa G, Carabelli M, Ruberti I (1994) Identification of distinct families of HD-Zip proteins inArabidopsis thaliana. In: Coruzzi GP (ed) Plant molecular biology. Springer-Verlag, Berlin, pp 412–426.
- ↑ A. H. Meijer, R. J. de Kam, I. d'Erfurth, W. Shen, J. H. C. Hoge. HD-Zip proteins of families I and II from rice: interactions and functional properties. Molecular and General Genetics MGG, February 2000, Volume 263, Issue 1, pp 12-21.
- ↑ 4.0 4.1 4.2 4.3 4.4 4.5 Mingqiu Dai, Yongfeng Hu, Qian Ma, Yu Zhao, Dao-Xiu Zhou. Functional analysis of rice HOMEOBOX4 (Oshox4) gene reveals a negative function in gibberellin responses. Plant Mol Biol (2008) 66:289–301.
- ↑ Dai M, Zhao Y, Ma Q, Hu Y, Hedden P, Zhang Q, Zhou DX (2007a) The rice YABBY1 gene is involved in the feedback regulation of gibberellin metabolism. Plant Physiol 144:121–133.
- ↑ Alabadi D, Gil J, Blazquez MA, Garcia-Martinez JL (2004) Gibberellins repress photomorphogenesis in darkness. Plant Physiol 134:1050–1057.
- ↑ Kaneko M, Itoh H, Inukai Y, Sakamoto T, Ueguchi-Tanaka M, Ashikari M, Matsuoka M (2003) Where do gibberellin biosynthesis and gibberellin signalling occur in rice plants? Plant J 35:104–115.
Structured Information
| Gene Name |
Os09g0470500 |
|---|---|
| Description |
Homeodomain leucine zipper protein |
| Version |
NM_001069971.1 GI:115479684 GeneID:4347333 |
| Length |
1716 bp |
| Definition |
Oryza sativa Japonica Group Os09g0470500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:18556879..18558594 |
| Sequence Coding Region |
18557207..18557276,18557394..18557740,18557867..18558283 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:18556879..18558594 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:18556879..18558594 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtgatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactga</cdnaseq> |
| Protein Sequence |
<aaseq>MKRPGGAGGGGGSPSLVTMANSSDDGYGGVGMEAEGDVEEEMMA CGGGGEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRAR WKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVK EEPAASDGPPAAGFGSSDSDSSAVLNDVDAAGAAPAATDALAPEACTFLGAPPAAGAG AGAAAAASHEEVFFHGNFLKVEEDETGFLDDDEPCGGFFADDQPPPLSSWWAEPTEHW N</aaseq> |
| Gene Sequence |
<dnaseqindica>329..398#516..862#989..1405#gaaaacagaaaggaaaccgagaaagagagagagagagagagaggtagggagggaagaagagtcactccacactccacactctcatcccctggtccctttcttggatcatgagaaaccgcgcaacaaaattgcaattctaggcagcatttggaccggggacttggctacgtggtgtttggccatggatcgcagcgtggaattaagaccggcgaggactcagcgacggaggcacccgcgtcattcctacgcttctgtgcccgtcgtcttctcgcagtgagagagagagagagatcgaccaggcgttcactgaattttactagaactcggcatgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtggtaatctttgttctttggttttccttttgtggcaattcattctttggaggtgatggtgtagtgtgatatgtgcgggaaattgagtgttttgtaattgtacatgcgtgttttgattagatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgaggtacgtgccgactgagtcgctgccctgccgtgccgcctgagctgttgctctgcgtgactgcgtcgagcagtcgttcgtttgcgcgcataatgtctgatggcttcttggtcgcgcgaattgtggcagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactgaagcaaatccggcgtaaccgcagccgagagagagagttggaaaacactatgcctgggggaataaagaattctgcaggaaagcagggtcttatctgcaattttgtaaaaaaaatggacctctacgtacttctctagtctcttttgccaattctcgcgcacattagctgtagcactgcagtgtagtaaaatcctactactccattacctctccaatttctagctctcacttccctacttaaactcatctgagctctaatgtaagcatatgccatccaaaatggaccataaatatgtcactagcagtaggatggt</dnaseqindica> |
| External Link(s) |