Os02g0477700

From RiceWiki
Revision as of 12:13, 10 June 2014 by Horatioguo (talk | contribs) (Evolution)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Dwarfing of F71 mutant plants typically appears at the reproductive growth stage (Fig. 1a). In order to understand the cell morphology of the dwarf phenotype of F71, we observed matured tissue in the third internodes. Longitudinal sections showed that all wild-type parenchyma cells were fully elongated and arranged in fine cell files along with the internode elongation axis (Fig. 1b), while most F71 parenchyma cells had irregular shapes and sizes, consequently exhibiting abnormally organized cell files (Fig. 1c). Cross-sections showed that F71 had normal vascular bundles and cortical fibres similar to wild type, but their parenchyma cells were unequal in size (Fig. 1d, e) and had thickened cell walls (Fig. 1d, e; insets). These abnormal parenchyma cells in F71 were strongly stained by the Mäule reaction (Fig. 1f, g), which detects guaiacyl and syringyl groups of the cell wall phenolic components. These results are consistent with the results reported by Nishikubo et al. (2000). Nishikubo et al. also reported that parenchyma cells in F71 ectopically deposit polysaccharide-linked hydroxycinnamoyl esters in their cell walls. Thus, the d50 mutation in F71 appears to induce abnormally shaped and sized cells and ectopic deposition of cell wall components specifically in the parenchyma of elongated internodes. In other organs such as roots and leaves, abnormally shaped cells were not observed.

Figure1.JPG

Genetic analysis of d50 gene using F71

To identify the d50 gene, linkage analysis was performed using F2 populations derived from a cross between the F71 (japonica cv.) and Kasalath (indica cv.).We selected 188 F2 individuals showing the same phenotype of F71 and used them for linkage analysis with 131 restriction fragment length polymorphism (RFLP) markers. All analysed F2 dwarf plants showed japonica patterns at each RFLP marker (R1989, C196 and R1736), indicating that the d50 gene was located on the long arm of chromosome 2. In order to determine its exact location, we designed CAPS markers (Supporting Information Table S1) around the three RFLP markers based on the DNA sequences available from the Rice Genome Annotation Project (http://rice.plantbiology.msu.edu/cgi-bin/gbrowse/rice/). Linkage analysis using 2053 mapping plants showed that the d50 locus is positioned within a broad region with a genetic distance of 2.2 cM between E61832S and R1736 (Fig. 2a);none of the CAPS markers between E61832S and R1736 showed any evidence of recombination. Therefore, it was difficult to further map the d50 with F2 progenies from a cross between F71 and Kasalath.

Expression

Please input expression information here.

Positional cloning of d50 gene with DMT9 mutant allele

D50 locus has been known to be allelic with d12 (Murai et al. 1990), d32 (Sato et al. 2002) and DMT9 (originally isolated from our research), which were derived from spontaneous mutation, g-ray irradiation and chemical mutagenesis with N-methyl-N-nitrosourea, respectively.These allelic mutants exhibit dwarf and abnormal internode parenchyma phenotypes similar to that of F71 (Supporting Information Fig. S1). To isolate the d50 gene, linkage analysis was performed using the F2 progenies collected from a cross between DMT9 and Kasalath. Linkage analysis using 990 mapping plants with CAPS markers between E61832S and R1736 progressively narrowed the d50 locus to a 43-kbp region (Fig. 2a). Within the 43-kbp region, six putative genes were identified. Sequence analysis of six putative genes in the DMT9 and its parent cultivar, Taichung 65, indicated a G-to-A mutation within one of the six putative genes. Sequence analysis of the products obtained from RT-PCR and RACE-PCR revealed that the candidate gene spans 3243 bp from the start to stop codon and encodes a 1080-aa peptide containing 11 exons and 10 introns (Fig. 2b). In the DMT9,G-to-A mutation at nucleotide 1023 results in theTGG codon (tryptophan) to a premature stop codon (Fig. 2b).

Figure 2.JPG

Expression pattern of D50 gene

To investigate the expression pattern of the D50 gene, we performed semiquantitative RT-PCR in various organs. Strong D50 gene expression was detected in young third internodes and other organs, such as the seedling, root, leaf blade, leaf sheath and young flower (Fig. 6a), indicating that the D50 gene is expressed ubiquitously in various rice organs.We next used the GUS reporter gene to confirm the expression pattern of D50. In the 10 transgenic plants with a promoter–reporter construct, strong GUS expression was observed in the IM (Fig. 6b), young leaves (Fig. 6b, d) and root apex (Fig. 6c, e).The GUS activity was weak in elongating cells from leaves and roots and diminished in elongated cells (Fig. 6b, c). These results indicate that D50 is strongly expressed in young tissues. The effect of the d50 mutation was observed only in the internode parenchyma and not in other organs such as the root and leaves, suggesting that D50 or hydrolysis of a unique D50 substrate is essential for the accurate formation of the internodes, and other 5PTases in rice may redundantly function in other organs.

Figure 6.JPG

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

d50 induces abnormal organization of actin network

We found the organization of actin in F71 to be disturbed, with thick actin bundles even in the normally shaped cells in the IM parenchyma, because of the defect of the d50 gene (Fig. 9). In agreement with this finding, mutations of FRA3 also have been shown to cause a thick actin formation in interfascicular fibre cells (Zhong et al. 2004). Thick actin cables appeared to be caused by bundling, which is reminiscent of F-actin bundling caused by the actin drug latrunculin B (Mathur et al. 2003). One study showed that in yeast and animals, PtdIns(4,5)P2 regulates actin polymerization by modulating actin regulatory proteins, such as cofilin, profilin, and capping proteins CapZ and gelsolin (Takenawa & Itoh 2001). In plants, PtdIns(4,5)P2 has also been shown to bind profilin (Kovar et al. 2001). Because PtdIns(4,5)P2 is a candidate substrate of D50, it is possible that the mutation of d50 directly affects actin organization. Abnormal thick actin bundles in F71 were accompanied with irregular deposits of pectins in the cell wall and abnormally oriented cell division in the IM (Figs 7–9). Baluška et al. (2001) have reported that epolymerization of actin filaments by latrunculin B induces a distorted cell division plane in maize roots, which is similar to the abnormally oriented cell division in F71. In addition, depolymerization of actin inhibits active endocytic internalization of cell wall pectins in meristematic maize root cells (Baluška et al. 2002). The importance of actin cytoskeleton has also been implicated in tip growing cells in which active endocytosis and exocytosis occur (Šamaj et al. 2004; Geisler et al. 2008). Therefore, the defect of the d50 gene in F71 most likely induces abnormal actin network organization in the parenchyma cells of the IM. Subsequently, there is a disruption in endocytic internalization of cell surface materials including pectins and/or balanced membrane trafficking between endocytosis and exocytosis, which may result in abnormal orientation of cell division and irregular deposition of pectins. To understand the detailed molecular mechanisms of phosphoinositide signalling during IM development, the nature of D50, such as its substrate specificity, ocalization and interacting proteins, should be investigated.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0477700

Description

Similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein)

Version

NM_001053379.1 GI:115446128 GeneID:4329359

Length

4131 bp

Definition

Oryza sativa Japonica Group Os02g0477700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:17139056..17143186

Sequence Coding Region

17142042..17142192,17142278..17142399,17142943..17143185

Expression

GEO Profiles:Os02g0477700

Genome Context

<gbrowseImage1> name=NC_008395:17139056..17143186 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:17139056..17143186 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>tctccagggcctattgacaacattatgcgttctactttgattgaggctgagccattatacaaacaatttgaatacatgaaagtgttggtgggttcttggaatgtcgggcaagaaaaggcatcttatgagtcactaagagcttggctaaagttaccgacaccagaggttgggttagtggtagttggattgcaggaggtggacatgggtgctggttttcttgcaatgtctgcagctaaagaaacagttgggctagagggaagcccaaacggagattggtggttggatgcaattgggcagcagttaaagggttactcttttgagcgtgttggctcgaggcagatggctggattgcttatctgtgtatgggtcagaacacatcttaagcagttcattggtgatattgataatgctgcggtagcatgtggattagggcgagcaatcggcaacaaggtacttctgttatcttattgccccactctttcttggcgcaagatgagcttgaaatgttgtttatga</cdnaseq>

Protein Sequence

<aaseq>SPGPIDNIMRSTLIEAEPLYKQFEYMKVLVGSWNVGQEKASYES LRAWLKLPTPEVGLVVVGLQEVDMGAGFLAMSAAKETVGLEGSPNGDWWLDAIGQQLK GYSFERVGSRQMAGLLICVWVRTHLKQFIGDIDNAAVACGLGRAIGNKVLLLSYCPTL SWRKMSLKCCL</aaseq>

Gene Sequence

<dnaseqindica>995..1145#788..909#2..244#atctccagggcctattgacaacattatgcgttctactttgattgaggctgagccattatacaaacaatttgaatacatgaaagtgttggtgggttcttggaatgtcgggcaagaaaaggcatcttatgagtcactaagagcttggctaaagttaccgacaccagaggttgggttagtggtagttggattgcaggaggtggacatgggtgctggttttcttgcaatgtctgcagctaaagaaacagtaagtcaagtttaagttctagtttttttaattaaagttatttgaacacatgtttttgttatttacttgcacttagtcatctgctactattatacagaccaaatcctagtaacactgaacaagagtgttgttagacatcttgctcttgttgattttttttgttgaataatcattatcattatgtataagatacctcgttgtacaaatgtacaatgttatcttgaccacaaaaaaatacgcttgtttgacaggctgtacctcttttctctatcagtatgattagagttaagctattttttgccacagttttattaaatgtctacaatacaacactgattggcacaggatccatgtgccatccttgcaatgagtggcagcatatggatgaaactcaatgacacaatgatttaaccttgtcttgcactcttgctaaagatcgttctgccgttagacttcccaagaatattaataaagtataacatgaaactggcatggtttttgctacttctaatcctgatacttttgtacgtccacttgctttaggttgggctagagggaagcccaaacggagattggtggttggatgcaattgggcagcagttaaagggttactcttttgagcgtgttggctcgaggcagatggctggattgcttatctgtgtatggtaatctgttcaggacttattttatcctgcagcttcatctgccttttgtttgtgtataaattattcagtttcttctttttctcagggtcagaacacatcttaagcagttcattggtgatattgataatgctgcggtagcatgtggattagggcgagcaatcggcaacaaggtacttctgttatcttattgccccactctttcttggcgcaagatgagcttgaaatgttgtttatgaggcatttgacttatcaaacatatcatgacaaattttgttttgatctaagcatttcatgctttagccatcatatttattggagatgtgttcatattctggaacatttgagttaagggggggaatacctttgctggccactatatgccaaaactccctttcatgtttaagcacaatgctgattagttcattctagagaaaggtagcaaggaggataagatataccatataggcatacagtatataataaaaaggaatatatgctatatgatggaaatgtagtgtgacagcaagtgctatttgatttgttttctttcatgcattcacatgttgaacattgtttgtttacttgtttaaaatgaacatcttggaagttctgaaagttcaagttgttaacgatgcactaagcaaaaagattattcacatttgtccccatattcatttggtagcagttgttgtgcaaaaccaataaatcattgttaccaagatgatatctggtggtttgtgcatacaattaatgaatgagaggtgtgcaatactgatcagaaaatgaaaaaaaaaagacaaattttaaaacacattatgggcctaaaatgtaaccacccactagttctgttatttttctgggggagtacagatattacttcaaaaggactgtattctgtcttatctgctgctttgttcatgtatgcctatattagggagcagtgggattgaggatgagaatacatgataggagtatttgctttgtaaattgccattttgctgctcatatggaagctgtgagtcgacggaatgaagattttgaccatgtctttagaacaatgacctttgccaccccttcgagtggaataatgacaacatcaggtgtttgttcaaccttttcccattatttttcagtattttccaatgggcattcaagtcaaatgacctgtaaatttgttgtgatattacaatcagcaatgagcaaatcttatacactgttacttgttttggtggtcttgcagtttctagttctactggccagcttcttcgaggagcaaatgtatggtgtattaatgttggttcattacattttctcggtggatagggagtagattctcatcttgatatactaagttgttcctattataatttacagggatcaagaatgcctgagttgtcagacacggacatgattgtctttcttggtgacttcaattaccgcctttatgatatttcctatgatgatgcaatgggcttagtttcccggagatgctttgactggctaaaaaataatgaccaactgcgagcagaaatgagatctgggagagtcttccagggactacgtgaaggggatttcaagtttccccctacatacaaatttgagaaacatacagcaggcttatcaggtatcttactttgttttttattcgtggaatcccaaagtacatataaagatcatcacctttatttgtcatatagggtatgatagcagtgagaagaggcgcattcctgcctggtgtgacagaatcctatatcgtgatagccgagttagttcagggaatgagtgttccttggattgtcctgtggtttcttcaatatcactgtaagttatttgttgtgcatgtttttttttaacccgaaaaagcttaaaatatgtcaataccttgttattatgttttccaggtatgactcttgcatggaagcaacagatagtgatcacaaacctataaaatctgtgttcaatttggatattgcttatgttgacaaacagacaatgaggcagaaatatgtggagctaatgagctcaaataataaagtggtgcatttgcttcaggaacttgaagcattccctggagtaaatataaataattctaacatcatcttgcaagatcggaatccatctgttgtgaaattgcaaaacagaacagaagtcatcgcttgttttgagatcattggacaagcaccaaatttgtccagcacacatttctctgcttttcctgcatggctaaaggtgagtcaatgctttgtctgactccttttactgtatttttattaaaataatctaatactagcaacgtacaaaaactttgcacgaccgaatttctcatgttttacatgggcacaactgcagagtagtagaaatattagtctcttcagtatcaagagttatgacaaaagagagcatatggtttcagttatactccctccgtttcaggttataagacgttttgactttggtcaaagtcaaactacttcaaatttgattaagtttatagacaaatatagtaatatttataatactaaattagtttattaaatcaataattgaatatatttttataataaatttgtcttgggttgaaaatgttattattgttttctacaaacttagtcaaacttgaagtaatttgactttgaccaaagtcaaaaacatcttataacctgaaacggaggtagtagtagattgacgcgttggcattagtaaaggcagactccagaatttgttattacttgttttgcttgttttattcttcaccattattaattcactgttgtgagcttaatgttttgaaaactgtgggcatatattcaatataggtctctccagcagtcggcataatatctccgggacagacggtagaggtcactttgcagcacagagacctgcatagccaacaaaactataatggaacttcattggatattttgcctggtggagctacccaacaaaaggcagcaactgtttttgcgaaaataactggagtatattcaacagttgcaaaatattacgaaatacatgtacaacaccagaactgcaggagcacattgccatcgagaggttataacttaggtgaccggtttttttaattttgagtttggtatcaggaatttaggaaatgtatgttgtatcaaatgttctttttgagtgaagtcacaaaatcaaggctttctactaccctcaacatgtgtattttcaagagaggaaaattgtaaacagtgtagc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0477700, RefSeq:Os02g0477700