Os07g0227800

From RiceWiki
Revision as of 09:13, 26 June 2014 by Littlescrew (talk | contribs) (Annotated Information)
Jump to: navigation, search

Please input one-sentence summary here.

OsABC1-9 contains 13 extrons and is located in chromosome 7, and this gene encodes a proteins with 793 amino acids.

Annotated Information

Function

Members of the activity of bc1 complex (ABC1) family are widely existed in prokaryotes and eukaryotes as protein kinases. These protein kinase members were initially isolated from Saccharomyces cerevisiae and were responsible to suppress a defect in mRNA translation of cytochrome b and maintain the activity of the bc1 complex in the mitochondrial respiratory chain [1]. Mitochondrial and chloroplast ABC1 proteins is associated in respiratory electron transport system and as a lipid-soluble antioxidant in yeast, Escherichia col, and human [2][3]. There are 15 non-redundant ABC1genes distributed on all rice chromosomes randomly except chromosomes 3, 8, 10, and 12 in rice, and were named from OsABC1-1 to OsABC1-15 according to their chromosomal location (table 1). However, there are 17 members of ABC1 family in Arabidopsis. All of these genes contain introns and the number of intron varies greatly, and intron gain was an important event accompanying the recent evolution of the rice ABC1 family [4].

'Table.1 Basic information of the rice ABC1 genes.(from reference) [4].

ABC1 domain is an important part of the ABC1 proteins, and aligned results show that the domains of all proteins were from 102–126 amino acids, except the OsABC1-14 and OsABC1-15 proteins. The length of the domain in OsABC1-14 and OsABC1-15 is 92 amino acids and 184 amino acids, respectively [4]. The XaXasX2QV segment that functions as a nucleotide-binding motif for protein kinases is highly conserved in ABC1 domain as well as lysine residue in N-terminal that as a binding site for chemical groups. In addition, other conserved amino acid valine and aspartate acid in the middle of the domain and glutamate acid in the C-terminal. It is also suggested that there are 10 putative motifs in rice ABC1 proteins (Fig1).

'Fig.1 Motif composition of rice ABC1 proteins.(from reference) [4].

The real-time PCR results show that 14 genes express mainly in leaves. The subcellular localization is predicted that OsABC1-1 and OsABC1-8 were localized in the cytoplasm, OsABC1-3 and OsABC1-6 in the plasma membrane, OsABC1-10 in mitochondria, OsABC1-14 in vacuoles and the others in chloroplasts [4]. Members of this family participate in the extensive abiotic stress response and may play roles in the tolerance of plants to adverse environments. Furthermore, some of the rice ABC1 genes may be involved in the oxidative stress response and ABA signaling[4].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • Jiangsu Provincial Key Laboratory of Crop Genetics and Physiology
  • Key Laboratory of Plant Functional Genomics of the Ministry of Education, Yangzhou University, China

References

  1. Bousquet I, Dujardin G, Slonimski P P. 1991. ABC1, a novel yeast nuclear gene has a dual function in mitochondria: It suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex. EMBO J, 10(8): 2023–2031.
  2. Villalba J M, Navas P. 2000. Plasma membrane redox system in the control of stress-induced apoptosis. Antioxid Redox Signal, 2(2): 213–230.
  3. Ernster L, Forsmark-Andree P. 1993. Ubiquinol: an endogenous antioxidant in aerobic organisms. Clin Investig, 71(8 Suppl): S60–S65.
  4. 4.0 4.1 4.2 4.3 4.4 4.5 GAOQing-song, ZHANGDan, XULiang, XUChen-wu. Systematic Identification of Rice ABC1Gene Family and Its Response to Abiotic Stress. Rice Science, 2011, 18(2).

Structured Information

Gene Name

Os07g0227800

Description

Conserved hypothetical protein

Version

NM_001065754.2 GI:297606926 GeneID:4342761

Length

5176 bp

Definition

Oryza sativa Japonica Group Os07g0227800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:7184984..7190159

Sequence Coding Region

7188636..7188824,7189131..7189273,7189683..7189818,7189954..7190058

Expression

GEO Profiles:Os07g0227800

Genome Context

<gbrowseImage1> name=NC_008400:7184984..7190159 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:7184984..7190159 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcggcggccgcgaggggcgccgccgcggcccgctccccgctcgtcctccaccgccacccccaccccgcgcaccaccgccgcctccgcctcctccccctggtggcgggcggcgggggaggctcgcccccgcgtgtggggaggaggatcagggccagccgggagaaggggcggcgggtcgggattagggttttcgcgaggtacagccaggcccaggacttctccactcgcctccaagatagagctggcgaattgcctaagttggttgaggaccttctacagacatcaattagcacagggccacgaggtgcttttaggtttgcccaagggatccaagctgtccttggggttggtggggagtggctaaatgacttctcaaagacagccaacacatcagcaggaataccagctcagatgcagctgggtttgctttctcctctttatcttagaaggctttttgagcgcatgggtgcaacttatatcaagctaggtcaggtaaggacatgttcatactttgcggtttatgctatcatcaactacaaaatgtgtccatctcaaaagaaaaaataa</cdnaseq>

Protein Sequence

<aaseq>MAAAAARGAAAARSPLVLHRHPHPAHHRRLRLLPLVAGGGGGSP PRVGRRIRASREKGRRVGIRVFARYSQAQDFSTRLQDRAGELPKLVEDLLQTSISTGP RGAFRFAQGIQAVLGVGGEWLNDFSKTANTSAGIPAQMQLGLLSPLYLRRLFERMGAT YIKLGQVRTCSYFAVYAIINYKMCPSQKKK</aaseq>

Gene Sequence

<dnaseqindica>1336..1524#887..1029#342..477#102..206#ctctctctctctctctcttcacgcttcccacgcgcgacacgaggttggagacgcgtcccgtgacgtcatcgtcgtccccgactccggcgagccccgcacccatggcggcggcggccgcgaggggcgccgccgcggcccgctccccgctcgtcctccaccgccacccccaccccgcgcaccaccgccgcctccgcctcctccccctggtcagtcactccgcccccgtctcatttcctcctcgatctctagctccctcctcttgggagtaggcgggattgggagctacctacctcgtgcttgattgaggtggtaattcggtcaactactgattggggttgcaggtggcgggcggcgggggaggctcgcccccgcgtgtggggaggaggatcagggccagccgggagaaggggcggcgggtcgggattagggttttcgcgaggtacagccaggcccaggacttctccactcgcctccaaggtaatcgattggttgatttctttccccatctctgtataattcgatttggtacttggttcaaagccactgtttaggcccagcttagttgaacatttgaacaagcgactgtttctcattaggcaggatacgggtgatgatgtaatatgaagcgagaatttccggtgtggattttcacgagtcgtgagtttgttttctgttcatcgcagtagcatagagaatgttatgtattttgggattcgggtgggtaaaatgtgtgtctcttcagattaatgtactccttattaacattcctcacaaaaataagtagttatgaacaatcttgggatagctagatcacagatgcattgaatattaagtttgtttgttcttcgcaaaatcatcccatgtctttgatttcgttcaaatgcagatagagctggcgaattgcctaagttggttgaggaccttctacagacatcaattagcacagggccacgaggtgcttttaggtttgcccaagggatccaagctgtccttggggttggtggggagtggctaaatgacttctcaaaggttatttcttgtttgtgttattcatctattttgtctaaaaacttgatcttagaatttctgagaactgaaacaatggaagcagctgtagactgaactactaatgaactactgatgtgttgagttggctgaggttgtatgggagaatattggggatttagggctagtctagatgtggatttttcatctatgtagaaaagaggaggttaaatttttgttggtgcacaatgaccaggtttatctaagatattttttttattgataactttggtttcagaagcgtaatatcctgctgttaatatgatgcagacagccaacacatcagcaggaataccagctcagatgcagctgggtttgctttctcctctttatcttagaaggctttttgagcgcatgggtgcaacttatatcaagctaggtcaggtaaggacatgttcatactttgcggtttatgctatcatcaactacaaaatgtgtccatctcaaaagaaaaaataaactacatgtgtatgtgttccttaattaatagattgtcttgaatttcttaatcttctgtaccttttgaaagaaatgccagaattcttcattttactttgtatatgtagcaaacagaaacaaagaccactaatatatctttcagcaacccagacaatagtcagttgcttacttgtcactagacaggtagagtaacctatctttagagtggtcctttgggatgggcaaagggagaggagttaaaatagttattcagtttaatagtcatatattttatgattatttcaacctggatagtcaactgactgtggtggtgcagttcgtagcttctgcaccaactttgtttcctgcagagtatgtcgaggaattccagaactgttttgaccgtgcaccacctgttccatatagtgagattgagtcaatattgcgtgaggagttgcaacagccgttggatagtgtatatgaatacattgatccagttccaatagcttctgcgtcaatagcacaggtttctgttgagaccatcagaagttctggactatttgttgtctggagctaaagcactgatataactttattcttatccaggttcatggggcaaggttgaagagctctcagaaggatgtggttatcaaggtcctcaagcctggtattgaagacactttggtggctgacctgaattttatctatgttgttgcacgtattttggaatttctaaaccctgaactacagaggacatcactggtgagttatcgcctaatgagtctttcactggacaggatttttttcattcattgaacaatcactggtcctggtggttctcggagcgcaggaaaccaaaatttactgctttctttagtataatcagaagccagaaggtcaaaatatatttttgtttgattcctgtatgcagcaagcaatgcatgccatgaaattgctcccatgaccatgaggatatgtttttcttttggtagttgaggcaagatcattgaacttttcacagttgatttacatgtatttttcaattctagccactgtgctagagttggcacaattaggtgcagaaacttttaatatctatatccttaaaatttattagttggattgaaggcaccacaatattcctaagatcagaaaaaatatgagtttaaaagattaacagaaaattcagaaaattctcccaataatcaagagagaaagaaatgtcttgccacttgcgtgttgttttgatggacctagattgtaacctagtagattaactatagttgttatagttgtgtaacaaatacaactgcacctctaatcattgatataagagctttatagcaaatggaattattgttaaatgtaatcatgcaactgcatggatatcccactaaaaaattgaatatcgaataaggaatatttcatggtggagcacaatatatcttgagcttgtgacatgaggagttgactatatatattattcacgtactataactaaaaaggaaaaaaaacaattagttcacacaaccagaaacaaatgaatactttatactttgtagttcatatatgtggaagtagagacagcatatagcaatcatgaaattttctgtatacttggttatccaaattttgtggtatcacaagttatagaagaatataataagagatgtccttatgctcagaattttatattataggtaggaattgtcaaggatataaaggaatctatgcttgaagaagttgatttcaggaaagaggctatgaatattgaggcttttcagaggtacatcgatgcaatgggatttgacaggcaggccaaagccccttttgtgtatcgccactgtagcacaaagcgtgtcctaactatggaaagattgtacggtgttccactcactgaccttgattctataaggtctcttgttcctgatcctgagctgactttagtcactgcacttaatgtctggtatgctccatgcgtccttgtgattccatacatcatatatttgggtatttctgccattcattgccttattcaatcctcagaataggcatgttgacatatgtgcaaaatgtgcaggtttggaagcttgatttcatgtgaatccttccatgcagatgtgcatgcaggaaatttatggttgctccgagatggacgtgttggatttcttgattttggtatgtaacatattctccaatctccacggtggcacggttgctctatatctcattaggcaatttaggatgcaccttgtatttgctaaaaaaggaaatattctggccttttaattcttacattatctattagtcaaaacacaaagtggtcaagaaagtttatcactattggttaataccatttcacaggaattgttggccggatatcgccaaggacctgggctgcaatggaggtctttttggcttcatttgcaactgacgattataatgctatggcatcagccctttctgaaatgggtgctacagggaatgatataaatgttaatgaatttgcaaaggacttggaaaaaatattctcatcaatacaggtaatatttcccaaaatagtaggttatttgatgtcatgaaggcctggttatcccgtgaacatggtgacccaatttcgactgttgaagtgccaaaaatgatgccagggtgaaacctgggctgtgtttcacaccaaaattggaagtttggttaaaattggaacgatgtgacggaaaagttggaagtttgtgtgtgtaggaaagtattgatgtgatggaaaagttggaagtttgaagaaaaactttggaactaaacacggcgctggtctggcagtagtaaaatgctgaatgcaagcaaaagtggcttatggacaggaatttttgtggctactggctagtcaaatttggatatcgttctttagttagtgttttaccacttatctcgtggttaattttcaattgcattctcatttgtgcgcaggatttggatactgaagtcatagttgcaacagcaagaactcctgatgctacagcagtatcggctaatgttgtcgttgacgagagacagatgaatgcattgtttcttgatctggtgagctactttcttttctctctcggttagaacaaggtagagagaacttctaccttatacattcgtatcactgtatgttcttgttggtaaatgttgcctgccagcgtgtattgttttcacgaaagaagagagatgagggaaaaaaaacaatgctgacaattctgttgctctgcgtcttccaggtgagggtcagcgagtcgtatggattgaaatttcctcgcgaattcgctcttctgatgaagcagcttctgtattttgatcgctacacaagattgttggctcccagcatgaacatgctgcgagatgagagggttaacattagctcccgccaacaggccagaagagtagatcgtttccagtgaccgatgcttgtgatacactgacaagtagtacgtaacaagctcgtgtaagtgtaacctactaactgtatatattttcaccagatcaacataggaatgaaccgcagtgcagcggccaaggaaaatttggacgagtataactggacattttcatagtagcaagtcgctctgtaaaaggtgtacgttaagatggaagtaaaatgtagagaaaatagaactgccggggccgctgggctgactcc</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0227800, RefSeq:Os07g0227800