Os01g0205700

From RiceWiki
Revision as of 07:38, 25 December 2014 by Zhangye (talk | contribs) (Mutation)
Jump to: navigation, search

OsGSK1 (Oryza sativa glycogen synthase kinase3-like gene 1), a member of the plant GSK3/SHAGGY-like protein kinase genes, with enhanced tolerance to various abiotic stresses and an orthologue of the Arabidopsis brassinosteroid insensitive 2 (BIN2), AtSK21[1][2].

Annotated Information

Function

Please input function information here.

Mutation

Figure 1. Salt and drought tolerance tests of OsGSK1 KO mutant.(from reference [1]).
Table 1. Wilting ratios for OsGSK1 knockout and non-transgenic plants after stress treatments.(from reference [1]).
  • To examine the role of OsGSK1 in the abiotic-stress response, Serry Koh et al. analyzed the tolerance of OsGSK1 KO

mutants by measuring chlorophyll fluorescence and the wilting ratio after 8-day-old seedlings were treated with drought, cold, salt, or heat (Fig 1 and Table 1).

  • Compared with our NT plants, the wilting ratios for KO mutants wereabout 20% lower after cold stress (4) and as much as 26% lower after heat (45) stress (Table 1).
  • The wilting ratios for KO were lower each 13% and 36% than NT plants by 100 mM and 250 mM NaCl treatment, respectively(Fig. 1A–C)For our drought-tolerance test, leaves from hydroponically grown 8-day-old KO and NT seedlings were air-dried on filter paper. Under normal growing conditions, the ratio of Fv to Fm was 0.82 ± 0.01 for both KO and NT plants(Fig. 1D).
  • However, changes in Fv/Fm values varied between these genotypes, showing a slower decline in the KO mutants. After 6 h of drought treatment, the KO ratio was reduced to 0.47 ± 0.15, which was >2-fold higher than that of NT plants. These data indicated that the OsGSK1 KO mutant had enhanced tolerance to drought stress.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

Knowledge Extension

Labs working on this gene

  • Department of Life Science, Sogang University, Seoul 121-742, Korea
  • Department of Biological Sciences, College of Natural Sciences, Seoul National University, Seoul 151-747, Korea
  • National Research Laboratory of Plant Functional Genomics, Department of Life Science, Pohang University of Science and Technology, Pohang 790-784, Korea
  • National key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan),Huazhong Agricultural University,Wuhan 430070,China

References

Please input cited references here.

Structured Information

Gene Name

Os01g0205700

Description

Similar to Shaggy-like kinase (Fragment)

Version

NM_001048876.1 GI:115435165 GeneID:4327089

Length

2630 bp

Definition

Oryza sativa Japonica Group Os01g0205700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:5773273..5775902

Sequence Coding Region

5773751..5773843,5773940..5774041,5774507..5774590,5774757..5774852,5774930..5774980
,5775085..5775225,5775684..5775740,5775825..5775902

Expression

GEO Profiles:Os01g0205700

Genome Context

<gbrowseImage1> name=NC_008394:5773273..5775902 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:5773273..5775902 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>cagcttttcagagggttagcttatattcatactgttccaggagtctgccacagggatgtgaaaccacaaaatgttttggttgatcctctcactcatcaagtcaagctatgtgactttggaagtgcaaaggttctggttcctggtgaaccgaacatatcatacatttgctctcgctattatcgtgctcctgagctcatatttggtgcaaccgagtatacaacttcaattgacatatggtcagctggatgcgttcttgcagagttacttcttggtcagccactgtttcctggagagagtgctgttgaccagctagtagagataatcaaggttcttggtactccaacccgtgaggaaatacgatgcatgaaccccaactatactgagttcaaatttcctcagattaaggctcatccttggcacaagattttccacaagagaatgcctccagaagccatagaccttgcttcccgtcttctccaatattcaccaagtctacgctgcactgctcttgacgcatgtgcacattccttctttgatgagctacgagagcccaatgcacgcctgccaaatggtcgtccattccctcctctgttcaacttcaagcatgaactagccagcgcctctccagaactcatccacaggctcataccggatcatatcagacggcaacatggcctcaactttgcgcatgctgggagctaa</cdnaseq>

Protein Sequence

<aaseq>QLFRGLAYIHTVPGVCHRDVKPQNVLVDPLTHQVKLCDFGSAKV LVPGEPNISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVD QLVEIIKVLGTPTREEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAIDLASRLLQ YSPSLRCTALDACAHSFFDELREPNARLPNGRPFPPLFNFKHELASASPELIHRLIPD HIRRQHGLNFAHAGS</aaseq>

Gene Sequence

<dnaseqindica>2060..2152#1862..1963#1313..1396#1051..1146#923..973#678..818#163..219#1..78#cagcttttcagagggttagcttatattcatactgttccaggagtctgccacagggatgtgaaaccacaaaatgttttggtatgacttatgtgaacaaggctacattacttctcttgcttggttgtttgttttgaactggtctctaattgcttgctgatacaggttgatcctctcactcatcaagtcaagctatgtgactttggaagtgcaaaggttctggtatgttgatttccacccttaagagtaatttctcagtggtttgatgtatgctgaaattattctagtggtaggctagtcataatgttgacagcataagtggtttatttcgtcatgttgcttttacgtgtagatatgctgcttttgcctttcatgattgatttgtgatagaagttaaaatttgcactgtgctgggatagacttttttagatagctcaatagttaataaaagaaattgcctatcatgatcaatatttccaaattggttttatcatgtgctgttattatgtcgaaggattgttaagtttattaagttggatgcaaagttgctgagctaggactataatgatgaattcctgagcttggattataactgttggcctctcttccctagttctgttatttcttcattttgctattttaacaaatagattgatgatctccttgtactattccaccaggttcctggtgaaccgaacatatcatacatttgctctcgctattatcgtgctcctgagctcatatttggtgcaaccgagtatacaacttcaattgacatatggtcagctggatgcgttcttgcagagttacttcttggtcaggttagtcactatatctttatctaaggaactgcaacattcaggttccttgattagattatgctgtgatgttattctgattatatttcataatgtgtatttgtcagccactgtttcctggagagagtgctgttgaccagctagtagagataatcaaggtattgcatgatgttgtgcaagctacatttttttttttgccacgggtatttcttgtgttaacttgatattatggcaggttcttggtactccaacccgtgaggaaatacgatgcatgaaccccaactatactgagttcaaatttcctcagattaaggctcatccttggcacaaggtagccatgttttcttatattggatcaccttcctcataccattttacttgcagggcattgtaggccacttcaaaaccagtttctgcatcatgtttaatttgaaataaaaaaaatgtatctgcagctgcttaactgatccatctgttgttctttcgcttaccaccagattttccacaagagaatgcctccagaagccatagaccttgcttcccgtcttctccaatattcaccaagtctacgctgcactgctgtgagttttctttcgtttgcttagttttatattatctataaatctattgttttcgctaagcgctaggataatgattatttacatggatttgcttattttagcatttcatttcaagtgttgttagctgttacagtcaaatattcatagaccgtgtgtcaagaacaataaacgaaatgtttctgttgaggtcccttatggaagtagattgatggatccctggtcctgcatggtcattgtaattataatatccagtggtccaaaaccaaattggtgtgttggctggtgaagagtgagtgcaactttcatacagtcgcatgtgcctgttaaatatagttgttagtgctccacttgaaaaagttgctgttaattgtttaaagcttatgctttagctggaaaacagtataatctctaaagcagcatgctggacattttcaaagagcttagcatttggttgattatatgcagcttgacgcatgtgcacattccttctttgatgagctacgagagcccaatgcacgcctgccaaatggtcgtccattccctcctctgttcaacttcaagcatgaagtaagtaaacgagaacattttcaaacagtcgctttttatggtacatttatatttacctgtcatggatgcttatcaatgctcatttctggtatgcagctagccagcgcctctccagaactcatccacaggctcataccggatcatatcagacggcaacatggcctcaactttgcgcatgctgggagctaaagggcaccgcgacgccaccgttttgttcgtttatttttccatgagctggacattgcaatcctagatgactccattgtcctggacttggactccatctcagattgcaccatccatgttccatgatccatccatccgtcaagccatttccgcaaggactcagtaccagagaagaagtacaattatgtaaattatctaaccatggagaaatgcgtgctgctgctgctggtgttaagtacgtgacggggcatgctggttgagtagtaggtaaggttaaggataaatgtagttggtggagactgagagacatgttaagctagggaaccctgctttccttcttttttttttctcctttcattttggtttcttcccattttgtgatccttagcattgccctacagtagtgtagctgctccctgtttttgtttgctctttcatcatgtaaatgccaatcccaatcgcaatgaaccctctttccttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0205700, RefSeq:Os01g0205700

  1. 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2