Os07g0186000

From RiceWiki
Revision as of 10:38, 2 January 2015 by Zhangye (talk | contribs) (Function)
Jump to: navigation, search

As a subgroup I h-type Trx in rice, OsTRXh1 regulates the redox state of the apoplast and influences plant development and stress responses[1][2].

Annotated Information

Function

OsTRXh1 could be secreted into the rice apoplast by transient expression and immunohistochemistry experiments. Furthermore, in the apoplast of rice, OsTRXh1 was induced by salt stress at the protein level. It has a conserved redox-active site (WCGPC), which involves in the redox status regulation of target proteins. OsTRXh1 not only had the ability to reduce insulin in the presence of DTT but also it can complement the hydrogen peroxide sensitivity of the thioredoxin-deficient yeast mutant. OsTRXh1 possesses disulfide reductase activity and could be secreted into the extracellular regions. The knockdown and overexpression transgenic plants in rice showed that it involved in salt and ABA response regulation. More hydrogen peroxide was produced in the extracellular space of OsTRXh1 knockdown plants than in wild-type plants under salt stress, whereas the OsTRXh1 overexpression plants produced less hydrogen peroxide under the same conditions,which suggesting that OsTRXh1 regulated apoplastic ROS accumulation and influenced plant stress responses in rice[1][2]. Recently, a report showed that OsTRXh1 was induced by cold stress and negatively regulated the kinase activities of Oryza sativa Mitogen-activated Protein Kinase3 (OsMPK3) and OsMPK6 in vitro through a redox-dependent mechanism[3].

GO assignment(s): GO:0005489, GO:0006118

Mutation

Expression

Please input expression information here.

Subcellular localization

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

knowledge extension

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0186000

Description

Similar to Thioredoxin h isoform 1

Version

NM_001065604.1 GI:115470940 GeneID:4342593

Length

1911 bp

Definition

Oryza sativa Japonica Group Os07g0186000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:4606471..4608381

Sequence Coding Region

4606739..4606894,4606976..4607098,4608199..4608288

Expression

GEO Profiles:Os07g0186000

Genome Context

<gbrowseImage1> name=NC_008400:4606471..4608381 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:4606471..4608381 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccgccgaggagggagtcgtgatcgcctgccacaacaaggacgagttcgacgcccagatgaccaaggccaaggaggccggcaaagtggtcataattgacttcactgcttcctggtgtggcccttgccgcttcatcgccccagtgttcgctgaatacgccaaaaagttccctggtgctgtcttcctgaaggttgatgttgatgagctgaaggaagttgctgaaaagtacaatgtcgaggcaatgccgaccttcctattcatcaaggatggtgctgaggctgacaaggtcgttggcgccaggaaggatgacctccagaacaccatcgtgaagcacgtcggtgccactgctgcatctgcttctgcctaa</cdnaseq>

Protein Sequence

<aaseq>MAAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCR FIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARK DDLQNTIVKHVGATAASASA</aaseq>

Gene Sequence

<dnaseqindica>1488..1643#1284..1406#94..183#gcaatctcatcgcaagaaaagaaaaaaaatcctattcaaatcgaaacccctctctttgatctcgtcgccgaggaattaggaggagagagagcaatggccgccgaggagggagtcgtgatcgcctgccacaacaaggacgagttcgacgcccagatgaccaaggccaaggaggccggcaaagtggtaagtttcctggcgcagaattttggggatttttttttgggggttttgttcaccagggggtcgcggttcgtcttagatcgataggattttgaagaaatttaggatttaatttcttgctgagatttgtggcatgtggtgaaatcgcgaggagatcgattgtttctattttggcgattggggcgtagggttgtcgcggatttggggattgccgattctggtgggggagattttagtagtagattttcatgaatatattttaggatgatataatgaacaattcttttaaaagaaatctgttgcagtaattacagggcactctgtatttgacatgattaatcgttgatgtttggattttaccatgagatggggcgatttgatgcttacatctgcaagcgaattttcatccgctatctgtatagtatttgactccataggcgaaattgttagtgtttaaatttaccgtaagatgggatggtgtgatgtgatgtttaggtttgctccagttgtttcatgctgatgattctctaatttgagtataagctttgtttaaatatatagatatattcttaaatagtactataatttgacatgattcgccagagttgaaggaaatctggttctaatctagttcaattgttgttatggacaatagattgccacttcacatgtcttggcattgttatgatgtgatgctttgtacagataagcgtccgccctgtagtattggatttggtttcttgctgcgcggcataaacgaggattttgaccaagagtattatatttgaactgtattagatttggtttcttgctgtgcggcatcaacgaggattttgatcaagagtagttagcacttaccaggctgatatattgttgtctatggaattatcaatggttcttggatttattttctttctgtgcaacaacaacaaggttgccaaagaatatttatctagtatgaaattctgaactagtggtacttatgcttgtcatgccaataactgtgaggctaccgttattctttcttactgcgcaattgaccatttgttcatgtcatgtttccatccctaatgatggccttttctggactgtttgatctacaggtcataattgacttcactgcttcctggtgtggcccttgccgcttcatcgccccagtgttcgctgaatacgccaaaaagttccctggtgctgtcttcctgaaggttgatgttgatgagctgaaggtgcgcagagttgcccacaatcttccaaaaacatttttgtcacccctgtgatagtgagtaatgcttttctttatccaacaggaagttgctgaaaagtacaatgtcgaggcaatgccgaccttcctattcatcaaggatggtgctgaggctgacaaggtcgttggcgccaggaaggatgacctccagaacaccatcgtgaagcacgtcggtgccactgctgcatctgcttctgcctaagaattctcgcaggcgcaagttatcaaataagggccagcacctggtgttgtagtaggtattagcgttagtcatcgttatcgtcagtttggcttgggtgtcctcgaatatcatgcgaaatcgattccgagttctctttttaaaattcctgatgatgatatatagtttgtggaaatttggatctggctattctgtacgagtttgctgactattaaagcaattattataatatgatgatgctggcaagcttgtagatagcttgaatttgtcc</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0186000, RefSeq:Os07g0186000

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3