Os05g0148600

From RiceWiki
Revision as of 06:59, 10 January 2015 by Zhangye (talk | contribs) (Evolution)
Jump to: navigation, search

OsNHX2(Os05g0148600), is a Na+‡and H+‡exchanger in rice (Oryza sativa)[1].

Annotated Information

Function

Figure 1. Genomic organization of the OsNHX2 genes.(from reference [1]).
  • OsNHX2 can suppress the Na+, Li+, and hygromycin sensitivity of yeast nhx1 mutants and their sensitivity to a high K+ concentration. The expression of OsNHX2 is regulated in rice tissues and is increased by salt stress, hyperosmotic stress, and ABA[1].
  • Anupama et al. obtained three clones (OsNHX2, 3, and 5) which were full length cDNAs. The genomic organization of OsNHX2 is graphically presented in Figure 1, OsNHX2 had 13 exons[1].
  • OsNHX1 and OsNHX2 transport excess K+ into the vacuole and play important roles in the tolerance of rice seedlings to high concentrations of KCl. The expression of OsNHX1, 2, 3, and OsNHX5 might be regulated through different ABA-dependent pathways[1].

GO assignment(s): GO:0006814, GO:0006885, GO:0015299, GO:0015385, GO:0016021

Expression

Figure 2. Expression of OsNHX1, 2, 3, and 5 in rice tissues.(from reference [1]).
  • Fukuda et al. examined the expression of OsNHX1, 2, 3, and 5 in various rice tissues by Northern-blot analysis with total RNA extracted from 8-day-old rice seedlings and 12-weekold rice (7 days after heading). Expression of these genes was regulated differently in different rice tissues (Fig. 2). Compared with other tissues, those of OsNHX2 were higher in flag leaf sheaths, culms, and panicles [1]
  • Treatment with high concentrations of KCl also notably increased the transcript levels of OsNHX1 and OsNHX2 in rice roots and shoots like NaCl[1].

Evolution

Figure 3. Phylogenetic analysis of Na+/H+ antiporter proteins.(from reference [1]).
  • The OsNHX proteins shared between 29 and 75% identity. OsNHX1 through 4 in particular shared high similarity, with more than 70% identity among OsNHX1 through 3 and more than 50% identity among OsNHX1 through 4. The sequence of LFFIYLLPPI, which is identified as the binding site of amiloride, an inhibitor of eukaryotic Na+/H+ antiporters, was identical among OsNHX1 through 3 and highly conserved in OsNHX4 and 5. The membrane-spanning segments M5 and M6 of OsNHX1, which are well conserved in the eukaryotic Na+/H+ antiporters, also shared high similarity with OsNHX2 through 5, and all of the OsNHX proteins contained the residues important for Na+/H+ antiport activity[2][3].
Figure 4. Phylogenetic tree of intracellular NHE/NHX exchangers.(from reference [4]).
  • OsNHX1 through 4, AtNHX1 through 4, and other most plant NHXtype antiporters are classified into a type I group, and OsNHX5, AtNHX5, AtNHX6, and LeNHX2 from L. esculentum are classified into the type II group (Fig. 3)[1].
  • Arabidopsis contains six NHX genes and rice has five, which are distributed in a similar way: AtNHX1–4 and OsNHX1–4 constitute class

I, and AtNHX5–6 and OsNHX5 constitute class II (Fig. 4). Members of the class-I category of Arabidopsis and rice show 54–87% similarity. Similarity among class-II members is 72–79%, but they are only 21–23% similar to class-I isoforms. These data indicate that divergence between class-I and class-II exchangers in plants occurred before the separation of dicotyledons and monocotyledons[4].

  • Pires et al. observe that multiple independent duplication events have occurred throughout the evolutionary history of the NHX family. Based on the reconciled phylogeny, Pires et al. estimate 27 independent gene duplication and 40 gene loss events during the diversification of this gene family[5].

Knowledge Extension

  • The Na+/H+‡exchanger that catalyzes the exchange of Na+‡for H+‡across membranes, contributes to regulation of internal pH, cell volume, and sodium level in the cytoplasm)[6].
  • Na+/H+ antiporters, which catalyze the exchange of Na+ for H+ across membranes, contribute to the regulation of internal pH, cell volume and the sodium level in the cytoplasm[7][8]. The antiporters are widespread membrane proteins found in animals, yeasts, bacteria and plants. In particular, vacuolar Na+/H+ antiporters, which compartmentalize Na+ into the vacuoles for detoxification, have been investigated as the key to salt tolerance in yeasts and plants[9].


Labs working on this gene

  • Division of Plant Sciences, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
  • Graduate School of Life and Environmental Sciences, Tsukuba University, Tennoudai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan
  • Instituto de Recursos Naturales y Agrobiologı´a, Consejo Superior de Investigaciones Cientı´ficas, Reina Mercedes 10, Sevilla 41012, Spain
  • Department of Biology and Center for Genomics and Systems Biology, New York University, New York, US

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Fukuda A, Nakamura A, Hara N, et al. Molecular and functional analyses of rice NHX-type Na+/H+ antiporter genes[J]. Planta, 2011, 233(1): 175-188.
  2. Bowers K, Levi B P, Patel F I, et al. The sodium/proton exchanger Nhx1p is required for endosomal protein trafficking in the yeast Saccharomyces cerevisiae[J]. Molecular Biology of the Cell, 2000, 11(12): 4277-4294.
  3. Hamada A, Hibino T, Nakamura T, et al. Na+/H+ Antiporter fromSynechocystis Species PCC 6803, Homologous to SOS1, Contains an Aspartic Residue and Long C-Terminal Tail Important for the Carrier Activity[J]. Plant physiology, 2001, 125(1): 437-446.
  4. 4.0 4.1 Pardo J M, Cubero B, Leidi E O, et al. Alkali cation exchangers: roles in cellular homeostasis and stress tolerance[J]. Journal of Experimental Botany, 2006, 57(5): 1181-1199.
  5. Pires I S, Negrão S, Pentony M M, et al. Different evolutionary histories of two cation/proton exchanger gene families in plants[J]. BMC plant biology, 2013, 13(1): 97.
  6. Orlowski J, Grinstein S. Na+/H+ exchangers of mammalian cells[J]. Journal of Biological Chemistry, 1997, 272(36): 22373-22376.
  7. Aronson P S. Kinetic properties of the plasma membrane Na+-H+ exchanger[J]. Annual Review of Physiology, 1985, 47(1): 545-560.
  8. Numata M, Orlowski J. Molecular cloning and characterization of a novel (Na+, K+)/H+ exchanger localized to the trans-Golgi network[J]. Journal of Biological Chemistry, 2001, 276(20): 17387-17394.
  9. Blumwald E, Aharon G S, Apse M P. Sodium transport in plant cells[J]. Biochimica et Biophysica Acta (BBA)-Biomembranes, 2000, 1465(1): 140-151.

Structured Information

Gene Name

Os05g0148600

Description

Similar to Na+/H+ antiporter

Version

NM_001061185.1 GI:115462100 GeneID:4337811

Length

6157 bp

Definition

Oryza sativa Japonica Group Os05g0148600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:2755436..2761592

Sequence Coding Region

2755718..2756056,2756437..2756520,2756628..2756690,2756793..2756931,2757561..2757662
,2757767..2757867,2758358..2758424,2758517..2758563,2758689..2758883
,2758966..2759012,2759140..2759199,2759685..2759782,2760662..2760780
,2760881..2761054

Expression

GEO Profiles:Os05g0148600

Genome Context

<gbrowseImage1> name=NC_008398:2755436..2761592 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:2755436..2761592 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggctggatttgggagctctcgttctcaaatccggcgggctgttggtgtcggactacgactcgatcgtcgcgatcaacatcttcgtggcgctgctgtgcagctgcattgtgatcgggcacctgctggaagggaaccggtgggtcaatgaatccatcaccgcgcttgtcatggggctgatcactggaggtgtgattctgctcgtcagtggtgggaagaactcgcacattcttgtgttcagtgaggacctcttcttcatttatttgcttccaccgatcatctttaatgctgggtttcaagtaaagaaaaaacaattcttccgcaattttatgacaattattttatttggtgctgtggggacattgatatcctttgtgataatctctctaggtgccatgacattgttcaaaaaacttgatgttggtccactccagcttggggactatcttgcaattggggctatcttctcagcaacagattctgtttgcaccttacaggtgcttaaccaagacgaaacacccctactctatagtctggtttttggtgaaggggttgtcaatgatgctacatctgttgtgctctttaatgcaattgaagacattgatattgctaattttgatagccttgttctactagcgttcataggaaattttctctacctattcttcaccagtacccttcttggagtagttgctgggttgcttagtgcctatattattaagaaactatgttttgccagacactcaactgacagagaagttgctatcatgatactcatggcgtacctttcatatatgctgtcgatgctgctagatctgagtggcattctcactgtgttcttctctggaatagtaatgtcacattacacttggcataatgtgacagaaagctctaggattactaccaagcacacttttgctactttatctttcattgctgaaatttttctatttctctatgttgggatggatgcactggacattgaaaaatggaaattagctagcagcagtcctaaaaaaccaattgctttaagtgcaactatattgggcttggttatggttggaagagcagcatttgtattccctttgtctttcttatccaatctaagtaaaaaagagacacgcccaaagatctccttcaagcagcaagtaatcatatggtgggcaggtctcatgagaggagcagtatcaatagcacttgcctatcacaagttcaccgcatctggtcatactgaattgcgaatcaatgctatcatgatcaccagcacagtcattgttgttctgttcagcacaatggtttttggtttttttaccaagcctctcctcaatctcctcatcccaccaaggcctgacatagcagctgatctctcaagccagtcaatcatagacccacttcttggaagcctgctggggtctgacttcgatgtaggccagccctcccctcagaacaaccttcagcttcttctcaccattcagactcgctccgttcatcgcgtgtggcgcaagtttgatgatagattcatgcgcccgatgttcgggggccgaggcttcgttcctttcgtgcctggttcgccagtggagcggagcatccatggatctcaactgggcactgtgactgaggctgaacatagctga</cdnaseq>

Protein Sequence

<aaseq>MGLDLGALVLKSGGLLVSDYDSIVAINIFVALLCSCIVIGHLLE GNRWVNESITALVMGLITGGVILLVSGGKNSHILVFSEDLFFIYLLPPIIFNAGFQVK KKQFFRNFMTIILFGAVGTLISFVIISLGAMTLFKKLDVGPLQLGDYLAIGAIFSATD SVCTLQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIEDIDIANFDSLVLLAFIGNF LYLFFTSTLLGVVAGLLSAYIIKKLCFARHSTDREVAIMILMAYLSYMLSMLLDLSGI LTVFFSGIVMSHYTWHNVTESSRITTKHTFATLSFIAEIFLFLYVGMDALDIEKWKLA SSSPKKPIALSATILGLVMVGRAAFVFPLSFLSNLSKKETRPKISFKQQVIIWWAGLM RGAVSIALAYHKFTASGHTELRINAIMITSTVIVVLFSTMVFGFFTKPLLNLLIPPRP DIAADLSSQSIIDPLLGSLLGSDFDVGQPSPQNNLQLLLTIQTRSVHRVWRKFDDRFM RPMFGGRGFVPFVPGSPVERSIHGSQLGTVTEAEHS</aaseq>

Gene Sequence

<dnaseqindica>5537..5875#5073..5156#4903..4965#4662..4800#3931..4032#3726..3826#3169..3235#3030..3076#2710..2904#2581..2627#2394..2453#1811..1908#813..931#539..712#atggccagatggacacgaccaccagtccaccacctcctcctctacttcttcttctcacgtctctctctctgaatccagatttttttttgttggttccatcctctctcctgcttcagatcagggtggccatctcgcttgaatctgcaggtgcgtgcggaatttcgatttttgtttttacttttattttgtgcacatccttttcttgagaggagaggtggcggcatggtggcttcttgggtcggatttggatttggagtcggaattgaggaattcagtgagaatatgtagctcggatcatctttcatcctactggtcactggtttgttgatttgggttgtggaatgattaagccgggagtgatttgctgttgctttgcggtttctctgaatttgttgacggctacagtgttcaggcaatcatggagatcgatctgcttgcttgcaccgagcaaatgatccaatttttaacattgagaattgttcgtttccattctgccagggtgagctgaggaggatccactgaggtggcggcggtcgagatggggctggatttgggagctctcgttctcaaatccggcgggctgttggtgtcggactacgactcgatcgtcgcgatcaacatcttcgtggcgctgctgtgcagctgcattgtgatcgggcacctgctggaagggaaccggtgggtcaatgaatccatcaccgcgcttgtcatggtgagatgagagggctctctggccttgcaccccaggtgtttgtggttttgccttacaggggagtggttttgagttttgttctgtgggttggcgcttgcaggggctgatcactggaggtgtgattctgctcgtcagtggtgggaagaactcgcacattcttgtgttcagtgaggacctcttcttcatttatttgcttccaccgatcatctttaatgctgggtgagctttctgtgtacctatagctcttctagtgagctcccaaccaaagcggaatttattttgttgttcttctgtacaagaaaagaaggtgccttgtcttagtttaatttggttttggctaatttaatcttgagagcaaaatgcaccgcaataggactcacttgagaaattcatgtatttctgaagtatgcatatgatgatattattattgccattctgtataaaatattacttagattcctctggatgtatcaaacccatgtttctaagacttcctcaaaacctatgtgatttgtgaatgctaaggtacacttattgagctggatgtataaaatagtcaactgcccacccattcccatgaaattatactgaaaaatgaattaaactatcacgtctgtcccaaacaattatttccccccctgaaatacagacttaaaaaggattgtatcacagtagtacatgaagcccttttacaattagaggacttggtgatgattggatccaagtatgtctaatcattcttacattcttactgaacgtgagtaagcttgtgagtcatttagattatttttcctgactgtgcaagtatatatatagtctttatagagaatcagcatccttactctgccctgtttcgaacctaggaaattgcatgcattcctgcagtaactgaattgattaatatgaatttcctgtgtatttctttggattagctaataacattttaagctccagcattatatttttgtgcagaaatacatgtattttcagttctcgctaaaacatttgaccctaacatcaaagtgatagcctgaagttacttacattttatataagtgaagcttttaactgaaatgcatctttgtttataatcatcaggtttcaagtaaagaaaaaacaattcttccgcaattttatgacaattattttatttggtgctgtggggacattgatatcctttgtgataatctctctaggtaagttgctgaattctttgctcagcttacatcatcttattttggttccatattaatgatcacaagataaccaactatatgaacacctacaccaaaatacaaaatcttggtgtttaacacctgaaaccaaatatcatcatttcaactttcaagtatgtgtgactgatttctttgagattaagataaattaaacactggtttaagagagtaaaagaatcagtaatgagccaatcgcttctatatgaagtggctacatgatgcatgaaaatccataattcagtacggagaagccagctggatagtttttttcagttgtggagctggatgtaaaagtatgtatgttagatgcacggttgtttgccttattgtattcattactcaatggtacaaacatgatttgttcaaagtctcaaaccttgcatcctcaaactttgatatgttgctctggccgctaagattttccttttttctaatggacatatcaggtgccatgacattgttcaaaaaacttgatgttggtccactccagcttggggactatcttggttagatactttattcttggcctttctacacttcaaaattattgaagcgactggttggactttggtaccattgaatacatcatcattctgctcgctgtttatctttttgtttaatccatatatgcagcaattggggctatcttctcagcaacagattctgtttgcaccttacaggtttttccatttaatgacctgttgttaatgtcttgtaaaatgaaacagcacaccattaaatatgcaattttgttacttgcaggtgcttaaccaagacgaaacacccctactctatagtctggtttttggtgaaggggttgtcaatgatgctacatctgttgtgctctttaatgcaattgaagacattgatattgctaattttgatagccttgttctactagcgttcataggaaattttctctacctattcttcaccagtacccttcttggagtagttgtaagtctctttgtttttgacaacctccactgatctttccttttcttttccatttactaccttcctttctgatgattcatttgaccatgcctttttggactaattactggtactcactttggcaggctgggttgcttagtgcctatattattaagaaactatgttttgccaggtctgctcctatgtgatttagtcatgccacagagtagtttgttttttatgtagatatgaaaatcattgtggcaagcttgtgatgttatgcagacactcaactgacagagaagttgctatcatgatactcatggcgtacctttcatatatgctgtcgatggtgagtgcctacaaactataagaacttcaaaataagcaactctcttaagtcaaattatttcggacatttatcaattacttcctccgtcccaaaatataagcatttttagtgctaagtcaaatatttttaactttgactattaatagcaaaaaaaaaagatcaatcccgtaaaattgatgttactagatttatcattaaacaagctatcataatatacaactctctttatttaaaacattttacttttatatagatatttttggtcaaagtagcatatcaaagactgtgtcgaaatccaaaaatgcttatattttgcgatggagggagtatcatgttatatccatgtaatactaagtgtaaatttgttgatgttttactcttgtacttcttttggcagtctgtaatttctttaatctcactttgcaccagcatcttccaaagtacatgatattgatattttttttgaccctttcatatatatatatttcagctgctagatctgagtggcattctcactgtgttcttctctggaatagtaatgtcacattacacttggcataatgtgacagaaagctctaggattactaccaagtatgtactgtctgataatcagttttactggcaacccttgtggtttcttttagatgaaaatatttatgtatatggcttcctgatattcttcattcattttacaggcacacttttgctactttatctttcattgctgaaatttttctatttctctatgttgggatggatgcactggacattgaaaaatggaaattagctagcagcaggtgtgtttttgtccacgaccaattcataaagtttcttctgatattttcattatccgatggtttggtttgcatccactggtgtagcgtgttattcattggtgggatccatggccagaataaaaacaaatgatcgtgttctttcatccattctctcctgtctgccaaaggaccgcacctgctcctttcatatgttggaaaccacgagcaagtatctttttttcggtttggttcaaacaaaagaactagttttgcttttttgtctgcctcctggttcaagtccccggtggtaatgccttgaacaattgcctctatggttcaatttttccatcactagggatgctgtaatttgcttagctccttcttagactgatggtcctgtcagctgacaaaagtatattctatgtgaggtgatatgttgttgatgagagaaagtcggaacccttccttttcagtttggagaagtctgcaaagaacatcttcaagcttctatgattctattaattgttgtttggcatggtgcacactgttaaacacaggctcacacaacagcaactaccttgcatgtcttgcccatgttttttttttctgaacataataactaatttatatcagttttccttatgatgcagtcctaaaaaaccaattgctttaagtgcaactatattgggcttggttatggttggaagagcagcatttgtattccctttgtctttcttatccaatctaagtaaaaaagagacacgcccaaagatctccttcaagcagcaagttagtattgaccttttttattcttatgtagttgtatcactttctttccctcctgaaaacagagggagctaagcagctaactgtgatgggtttattctctaggtaatcatatggtgggcaggtctcatgagaggagcagtatcaatagcacttgcctatcacaaggtgatgtttgatggttaacctgcctctctgaaagtgatttggaaccactaccacattaatttactaaaacctagtctgatatgtaacgttctcgtaaaactttgcagttcaccgcatctggtcatactgaattgcgaatcaatgctatcatgatcaccagcacagtcattgttgttctgttcagcacaatggtaaggatgtaatgctttctctctgttattatcttggatggttattttctgctcagcaggtgtatttctagcaatctgttgatagatttgtgcacttttgtttgtgtgtgctatatttggttcagccaagtcaataggggacatgtgattatatgagcgtaaacaaatctaatgcagtatttatcatttctttatatgacgcttacagattaagtgaaatacccatgaacaatgcagccatacggggattatcaatgtatatgatcctgtttaatctagaaaagaagtgatatcatacatttccgtttccatcgtgtacaaagaaagtagtccaattattatcactttgctaatgtatacaccatcaatatttgtttcaggtttttggtttttttaccaagcctctcctcaatctcctcatcccaccaaggcctgacatagcagctgatctctcaagccagtcaatcatagacccacttcttggaagcctgctggggtctgacttcgatgtaggccagccctcccctcagaacaaccttcagcttcttctcaccattcagactcgctccgttcatcgcgtgtggcgcaagtttgatgatagattcatgcgcccgatgttcgggggccgaggcttcgttcctttcgtgcctggttcgccagtggagcggagcatccatggatctcaactgggcactgtgactgaggctgaacatagctgagtttgaggttcagaaggtgcaagcatttctgtaaattttcagagaccactcaattttgttccaggatacatttgtgtactgttgtcatatcttgtgcagatagtttgtgtagaacgacgtatttaagctggtataggttcatattggaagccattattccaagtgtataattcatctgtaaatttacatgttgtttgtagaggataaacaaatgcattgtattggatttgtagaaagtactccctctttgttaaatttaaatgaaggtgccacagttttcat</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0148600, RefSeq:Os05g0148600