Os07g0556800
Oryza sativa Ribosome-inactivating protein gene 18 (OSRIP18) may be potentially useful in further improving plant tolerance to various abiotic stresses by over-expression[1].
Contents
Annotated Information
Function
- OSRIP18(Os07g0556800) might play a role in increasing tolerance to drought and high salinity during panicle development but not in seedling stage. After overexpression, active expression can be detected in all tested developmental stages and as a result, the transgenic plants exhibited higher tolerance to both stresses in these stages[1]. It means the gene may play a role as a member of natural defense system against various environmental conditions including drought and high salinity stresses[2].
- OSRIP18 may play a role in pollen development by sensing different environmental cues, the gene may play important roles as a member of natural defense system against varying environmental conditions during pollen development[2].
- OSRIP18 and other rice RIP genes may be potentially useful for developing new plant varieties with higher tolerance to various stresses[2].
GO assignment(s): GO:0017148, GO:0030598
Mutation
transgenic lines[1]:
- UT66
- UT71
- UT3
- UT64
To investigate the biological functions of the OSRIP18 gene, it was ectopically expressed under the control of 35S promoter. Totally, 33 transgenic plants were generated with this construct. These plants were integrated 1–4 copies of the construct by southern blot analysis. Among them, 11 independent transgenic plants contained single copy insertion of the T-DNA and they were used for further investigation. All of them showed significantly increased tolerance to drought and high salinity stresses.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Knowledge Extension
Labs working on this gene
- Rice Functional Genomics Group, Temasek Life Sciences Laboratory, 1 Research Link, The National University of Singapore, Singapore 117604, Singapore
- Republic Polytechnic, 9 Woodlands Ave 9, Singapore 738964, Singapore
References
- ↑ 1.0 1.1 1.2 Jiang S Y, Bhalla R, Ramamoorthy R, et al. Over-expression of OSRIP18 increases drought and salt tolerance in transgenic rice plants[J]. Transgenic research, 2012, 21(4): 785-795.
- ↑ 2.0 2.1 2.2 Jiang S Y, Ramamoorthy R, Bhalla R, et al. Genome-wide survey of the RIP domain family in Oryza sativa and their expression profiles under various abiotic and biotic stresses[J]. Plant molecular biology, 2008, 67(6): 603-614.
Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref4" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref5" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref6" defined in <references> is not used in prior text.
Structured Information
| Gene Name |
Os07g0556800 |
|---|---|
| Description |
Ribosome-inactivating protein family protein |
| Version |
NM_001066499.1 GI:115472730 GeneID:4343572 |
| Length |
1037 bp |
| Definition |
Oryza sativa Japonica Group Os07g0556800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:22882458..22883494 |
| Sequence Coding Region |
22882542..22883438 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:22882458..22883494 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:22882458..22883494 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaa</cdnaseq> |
| Protein Sequence |
<aaseq>MVKPAAVLLLLYLPLLATPTRIGLSRNPFVPPPNSVPTIDRTEM DVSTSPYRDLIKKWRDLVLLNTRPEVMVPEDHPVLAPQYDDTVPPERLLLPKLVANGD KTATLALRDSNIYFIGFANKAGQWFSFKDRNDLPPSFRARPLSFGVDYASIAGFRKNL PNYPLGRRQTEWAVKVLSEYDPNRTDEATIKRAVVIILLTFCEALRFFPIRNAVEIGW DSVAYITSTDADRLVCWGQISYMLEYSFMSGHSWDSEEQRTRLKNLARDCKIFNEPQA LETVDVLEYGAILGAKSTNWLY</aaseq> |
| Gene Sequence |
<dnaseqindica>57..953#aaaaaaagcccaaaccttcaagttcacctttgcttaattgcaccagcttagccgtcatggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaatgcaaggtgtaagcgccctcctagctaatataggcgcacttccacaatttatgtactccaatattatgcaactcacatggtgtg</dnaseqindica> |
| External Link(s) |
