Os03g0286900
OsRCI2-5 is a member of RCI2 genes in rice[1].
Contents
Annotated Information
Function
OsRCI2-5 gene improved the drought resistance of Nipponbare. OsRCI2-5 might play a significant role in the cold stress-signaling pathway[1].
GO assignment(s): GO:0005554, GO:0016021
Mutation
Transgenic rice group[1]:
- T13
- T26
- T34
- Treatment with 5% PEG had a very small impact on all of the rice seedlings;
- Treatment with 15% PEG severely influenced all of the seedlings.
- When treated with 10% PEG, the transgenic rice group and the WT group reacted differently. With 10% PEG, most rice leaves turned yellow and began to curl on the third day, and there were no significant differences between the overexpressed OsRCI2-5 transgenic rice group and the WT group (Figure 1A).
- On the tenth day, the transgenic rice group began to demonstrate restored growth that was evidenced by expanded and green leaves, while all plants in the WT group died (Figure 1B), which suggesting that OsRCI2-5 transgenic plants have stronger drought tolerance capacities than WT plants.
Expression
- Gene expression profiling showed that the OsRCI2-5 gene was expressed in the rice leaves, stems, and flower organs. The protein function prediction revealed it to be low temperature-inducible[1].
- Li et al. detected OsRCI2-5 expression in the leaves of seedling-stage rice via GUS activity detection, and found that it was mainly expressed in the veins. It was also expressed in the internodes of the tillering stage and the spikelets of the booting stage, especially the anthers and lemmas[1].
Subcellular localization
- The OsRCI2-5-GFP fusion protein was found to concentrate in the cell membrane[1].
Evolution
- Sequence analysis of OsRCI2-5 showed that it was localized to chromosome 3 and contained an intron, two exons, and a 165-bp open reading frame that encoded a 55-amino acid sequence and contained two conservative hydrophobic domains[1].
- Sequence comparisons were performed between the OsRCI2 and OsRCI2-related proteins. These sequences were divided into three clusters (Figure 2). OsRCI2-5 belonged to the second cluster, which also contained RCI2 sequences from maize, sorghum, and grape. According to the analysis results, the RCI2 protein sequences were conservative, and all sequences were predicted to be related to stress treatment. A homolog also exists in eukaryotes such as yeasts and worms. The homologous protein in yeast, PMP3, maintains the sodium ion balance[1][2]
Knowledge Extension
Arabidopsis thaliana contained eight RCI2 genes, while rice contained the following seven genes: OsRCI2-3, OsRCI2-5, OsRCI2-6 (Oslti6B), OsRCI2-8, OsRCI2-9, OsRCI2-10 (Oslti6A), and OsRCI2-11. The RCI2 family has a highly conserved gene structure, of which, most had two exons and one intron and encoded two transmembrane domains[1].
Labs working on this gene
- State Key Laboratory of Hybrid Rice, Hunan Hybrid Rice Research Center, Changsha, China
- Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha, China
- College of Agriculture, Hunan Agricultural University, Changsha, China
References
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Li L, Li N, Song S F, et al. Cloning and characterization of the drought-resistance OsRCI2-5 gene in rice (Oryza sativa L.)[J]. Genetics and molecular research: GMR, 2014, 13(2): 4022.
- ↑ Navarre C, Goffeau A. Membrane hyperpolarization and salt sensitivity induced by deletion of PMP3, a highly conserved small protein of yeast plasma membrane[J]. The EMBO journal, 2000, 19(11): 2515-2524.
Structured Information
| Gene Name |
Os03g0286900 |
|---|---|
| Description |
Similar to Low-temperature induced protein lt101.2 |
| Version |
NM_001056311.1 GI:115452350 GeneID:4332481 |
| Length |
610 bp |
| Definition |
Oryza sativa Japonica Group Os03g0286900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:9950439..9951048 |
| Sequence Coding Region |
9950667..9950750,9950875..9950955 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:9950439..9951048 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:9950439..9951048 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgtcggcgacgttcctggaggtgctcctagccatcttcctgccgccggtcggcgtcttcctgcgctacggcttgggtattgagttctggatcgatctcttgctgaccatactgggatacatcccggggatcatctacgcggtgtatgtgctggtggcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MASATFLEVLLAIFLPPVGVFLRYGLGIEFWIDLLLTILGYIPG IIYAVYVLVA</aaseq> |
| Gene Sequence |
<dnaseqindica>299..382#94..174#agttccagccatttcgtcagtgagggagagagagaggtctgagaagaggagagagagccttctgcctgacaagaaattctgagaagagggagaatggcgtcggcgacgttcctggaggtgctcctagccatcttcctgccgccggtcggcgtcttcctgcgctacggcttgggtgtaagttgcatgcgaggcacacttaattcttaactgatatagttcttgttgcagtatgtgcttgtgtgtgtgtttgatgccgtttgatttggatcctgtttctgatttggggtactgtttgcagattgagttctggatcgatctcttgctgaccatactgggatacatcccggggatcatctacgcggtgtatgtgctggtggcctgatcgaaagagttcgagcagagccagcgtcgggtgatcgagcgatcgtgcaacggtgcaatagcaactgatgctgtgctgtggtgttaagagtacatttgtatgtgtgaaaatgtgatttatgcgatgagattagggtcttgacgtcttgtgatgagagtctttatgctattttagagactgtaattgggtgtcatgttgcttgtttctcttatctaagatacttttttg</dnaseqindica> |
| External Link(s) |