Os01g0248900

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen. ＝RNA coding sequence= /translation="MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG

                    ACGYGDLYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTATN
                    FCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRVPCQRSGGIRF
                    AVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRNWGANWQSNARLDGQALSF
                    RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY"

ORIGIN

       1 gacgcgacaa tggcggccgc cagaatgctc gtgctcctgg cctctctctg cgctctcctg
      61 ctcacggcgt ccgcggccaa atggactcct gccttcgcga cgttctacgg cggcagcgac
     121 gcctccggca ccatgggcgg cgcatgcggg tacggcgacc tgtacggcgc cgggtacggg
     181 acgcggacgg cggcgctgag cacggcgctg ttcaacggcg gcgcgtcgtg cggcgcctgc
     241 ttcaccatcg cctgcgacac ccgcaagacg cagtggtgca agccggggac gtccatcacc
     301 gtgacggcga ccaacttctg ccctccaaac tacgccctgt ccggcgacgc cggcgggtgg
     361 tgcaacccgc cgcgccgcca cttcgacatg tcgcagccgg cgtgggagac gatcgcggtg
     421 taccgcgccg ggatcgtgcc cgtgaactac cgccgcgtgc cgtgccagcg gagcggcggc
     481 atccggttcg ccgtgaacgg gcacagctac ttcgagctgg tgctggtgac gaacgtcggc
     541 ggcagcggcg cggtggcgca gatgtggatc aaggggtccg ggacggggtg gatggcgatg
     601 agccgcaact ggggcgcgaa ctggcagagc aacgcgcgcc tcgacgggca ggcgctgtcg
     661 ttccgggtgc aggccgacga cggccgcgtc gtcacggcgg ccgacgtcgc gccggcgggg
     721 tggtcgttcg gcgccaccta cacctcctcg gctcagttct actgatgagc attaattgca
     781 agcctatctc atttaattaa tctggaccgt tcgatgtagt atattgtatg ctttgatcga
     841 cgtggcatag gatggaagag gccgcccacg aagaaaattt gggacttgtg tat

protein 3D structure

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1. The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan.

2. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb.

3. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1.

4. The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11.