Clinical and biochemical assessment of a modified evaporated milk for infant feeding.

N R Belton, F Cockburn, J O Forfar, M M Giles, J Kirkwood, J Smith, D Thistlethwaite, T L Turner, E M Wilkinson
Author Information

Abstract

A clinical and biochemical evaluation has been made of a new milk formula, Modified Carnation milk (MCM), based on cows' milk but with the mineral content and concentration of caloric nutrients altered to make it correspond more closely to human milk. MCM produced higher plasma calcium and magnesium concentrations in 6-day-old infants than those produced by unmodified evaporated and dried milks, achieving concentrations closer to those of breast milk. Plasma free amino acid concentrations in MCM-fed infants are nearer breast-fed values than those in unmodified milk-fed infants where higher individual plasma amino acid concentrations persist during the first 3 months. MCM-fed infants had low plasma urea concentrations and lower urine osmolalities at 6 days, 3 weeks, 6 weeks, 3 months, and 6 months than infants fed on the evaporated and dried milks, and similar plasma urea and urine osmolalities to those of breast-fed infants. MCM is likely to be superior to unmodified evaporated and dried milks in preventing convulsions of the hypocalcaemic/hypomagnesaemic/hyperphosphataemic type, and seems less likely to cause hypertonic dehydration. MCM is easily prepared, readily accepted by babies, and appears to be nutritionally adequate for the feeding of term infants.

References

  1. J Clin Pathol. 1960 Mar;13:156-9 [PMID: 13821779]
  2. J Lipid Res. 1965 Jul;6:431-3 [PMID: 14336215]
  3. Clin Chim Acta. 1964 Dec;10:530-5 [PMID: 14254104]
  4. Pediatrics. 1964 Jun;33:969-74 [PMID: 14169644]
  5. Scand J Clin Lab Invest. 1960;12(4):402-7 [PMID: 13738785]
  6. Pediatrics. 1951 Dec;8(6):778-87 [PMID: 14911248]
  7. Am J Dis Child. 1972 Aug;124(2):282-93 [PMID: 4559534]
  8. Lancet. 1973 Oct 13;2(7833):811-4 [PMID: 4126615]
  9. Lancet. 1972 Jan 15;1(7742):135-9 [PMID: 4108994]
  10. Lancet. 1968 May 18;1(7551):1045-8 [PMID: 4171741]
  11. Lancet. 1965 Nov 27;2(7422):1099-105 [PMID: 4158806]
  12. Arch Dis Child. 1974 Nov;49(11):867-73 [PMID: 4474842]
  13. Acta Paediatr Scand. 1974 May;63(3):347-50 [PMID: 4838964]
  14. J Obstet Gynaecol Br Commonw. 1974 Mar;81(3):210-9 [PMID: 4406282]
  15. Br Med J. 1973 Apr 7;2(5857):15-7 [PMID: 4739638]
  16. Br Med J. 1973 Apr 7;2(5857):12-5 [PMID: 4739637]
  17. Br Med J. 1973 May 12;2(5862):340-2 [PMID: 4739982]
  18. Arch Dis Child. 1973 Jul;48(7):563-5 [PMID: 4740498]
  19. Br Med J. 1973 Jun 30;2(5869):762-4 [PMID: 4740463]
  20. Arch Dis Child. 1973 Feb;48(2):99-108 [PMID: 4690525]
  21. Arch Dis Child. 1972 Apr;47(252):257-60 [PMID: 5067342]
  22. J Clin Endocrinol Metab. 1972 May;34(5):767-71 [PMID: 5012492]
  23. Arch Dis Child. 1975 Sep;50(9):731-4 [PMID: 1190823]
  24. Br Med J. 1975 Mar 22;1(5959):653-5 [PMID: 1168521]
  25. Am J Obstet Gynecol. 1975 Mar 1;121(5):622-5 [PMID: 1115164]
  26. Br Med J. 1971 May 22;2(5759):432-6 [PMID: 5108384]
  27. Pediatrics. 1970 Feb;45(2):216-24 [PMID: 5467062]
  28. Acta Endocrinol (Copenh). 1970 Apr;63(4):655-66 [PMID: 5468287]
  29. Postgrad Med. 1969 Dec;46(6):135-9 [PMID: 5352927]
  30. Am J Clin Nutr. 1965 Sep;17(3):180-3 [PMID: 5825387]

MeSH Term

Amino Acids
Blood Proteins
Calcium
Growth
Humans
Infant
Infant Food
Infant Nutritional Physiological Phenomena
Infant, Newborn
Milk, Human
Osmolar Concentration
Phosphorus
Skinfold Thickness
Sodium
Urea

Chemicals

Amino Acids
Blood Proteins
Phosphorus
Urea
Sodium
Calcium

Word Cloud

Created with Highcharts 10.0.0infantsmilkconcentrationsMCMplasmaevaporatedunmodifieddriedmilks3months6biochemicalproducedhigheraminoacidMCM-fedbreast-fedureaurineosmolalitiesweekslikelyfeedingclinicalevaluationmadenewformulaModifiedCarnationbasedcows'mineralcontentconcentrationcaloricnutrientsalteredmakecorrespondcloselyhumancalciummagnesium6-day-oldachievingcloserbreastPlasmafreenearervaluesmilk-fedindividualpersistfirstlowlowerdaysfedsimilarsuperiorpreventingconvulsionshypocalcaemic/hypomagnesaemic/hyperphosphataemictypeseemslesscausehypertonicdehydrationeasilypreparedreadilyacceptedbabiesappearsnutritionallyadequatetermClinicalassessmentmodifiedinfant

Similar Articles

Cited By (1)