The amino acid sequence and reactive site of a single-headed trypsin inhibitor from wheat endosperm.

E Poerio, C Caporale, L Carrano, C Caruso, F Vacca, V Buonocore
Author Information
  1. E Poerio: Dipartimento di Agrobiologia e Agrochimica, Università della Tuscia, Viterbo, Italy.

Abstract

The sequence of a trypsin inhibitor, isolated from wheat endosperm, is reported. The primary structure was obtained by automatic sequence analysis of the S-alkylated protein and of purified peptides derived from chemical cleavage by cyanogen bromide and digestion with Staphylococcus aureus V8 protease. This protein, named wheat trypsin inhibitor (WTI), which is comprised of a total of 71 amino acid residues, has 12 cysteines, all involved in disulfide bridges. The primary site of interaction (reactive site) with bovine trypsin has been identified as the dipeptide arginyl-methionyl at positions 19 and 20. WTI has a high degree of sequence identity with a number of serine proteinase inhibitors isolated from both cereal and leguminous plants. On the basis of the findings presented, this protein has been classified as a single-headed trypsin inhibitor of Bowman-Birk type.

References

  1. J Biochem. 1987 Aug;102(2):297-306 [PMID: 3667571]
  2. J Biochem. 1986 Oct;100(4):975-83 [PMID: 3818572]
  3. Nature. 1970 Aug 15;227(5259):680-5 [PMID: 5432063]
  4. J Biochem. 1978 Mar;83(3):737-45 [PMID: 641033]
  5. FEBS Lett. 1979 Mar 1;99(1):97-100 [PMID: 437138]
  6. Biochem Biophys Res Commun. 1966 Aug 12;24(3):346-52 [PMID: 5967094]
  7. J Biochem. 1977 Dec;82(6):1523-31 [PMID: 599141]
  8. Plant Mol Biol. 1989 Dec;13(6):701-10 [PMID: 2491685]
  9. J Biochem. 1972 May;71(5):839-48 [PMID: 4672481]
  10. J Nutr Sci Vitaminol (Tokyo). 1979;25(1):43-52 [PMID: 448476]
  11. Biochemistry. 1985 Apr 23;24(9):2105-8 [PMID: 3888266]
  12. J Nutr Sci Vitaminol (Tokyo). 1982;28(4):419-29 [PMID: 7175581]
  13. Annu Rev Biochem. 1980;49:593-626 [PMID: 6996568]
  14. Nature. 1962 Jul 21;195:281-3 [PMID: 14491328]
  15. Biochem J. 1963 May;87:281-4 [PMID: 13968438]
  16. Eur J Biochem. 1992 Mar 1;204(2):433-51 [PMID: 1541261]
  17. Proc Soc Exp Biol Med. 1946 Dec;63(3):547-50 [PMID: 20281108]
  18. Eur J Biochem. 1979 Jun;97(1):85-91 [PMID: 477675]
  19. FEBS Lett. 1988 Feb 29;229(1):111-8 [PMID: 3162215]
  20. Arch Biochem Biophys. 1959 May;82(1):70-7 [PMID: 13650640]
  21. J Biochem. 1981 Sep;90(3):721-8 [PMID: 7309695]
  22. J Biol Chem. 1975 Jun 10;250(11):4261-7 [PMID: 1126951]
  23. J Biochem. 1990 Oct;108(4):669-72 [PMID: 2292595]
  24. Eur J Biochem. 1984 Sep 17;143(3):677-84 [PMID: 6479167]
  25. FEBS Lett. 1993 May 24;323(1-2):73-6 [PMID: 8495751]
  26. Sci Sin B. 1982 Mar;25(3):268-77 [PMID: 6125033]
  27. J Biochem. 1983 Aug;94(2):589-99 [PMID: 6630176]

MeSH Term

Amino Acid Sequence
Binding Sites
Chromatography, High Pressure Liquid
Disulfides
Molecular Sequence Data
Peptide Mapping
Sequence Homology, Amino Acid
Triticum
Trypsin Inhibitors

Chemicals

Disulfides
Trypsin Inhibitors

Word Cloud

Created with Highcharts 10.0.0trypsinsequenceinhibitorwheatproteinsiteisolatedendospermprimaryWTIaminoacidreactivesingle-headedreportedstructureobtainedautomaticanalysisS-alkylatedpurifiedpeptidesderivedchemicalcleavagecyanogenbromidedigestionStaphylococcusaureusV8proteasenamedcomprisedtotal71residues12cysteinesinvolveddisulfidebridgesinteractionbovineidentifieddipeptidearginyl-methionylpositions1920highdegreeidentitynumberserineproteinaseinhibitorscerealleguminousplantsbasisfindingspresentedclassifiedBowman-Birktype

Similar Articles

Cited By