Exercise influences spatial learning in the radial arm maze.

B J Anderson, D N Rapp, D H Baek, D P McCloskey, P S Coburn-Litvak, J K Robinson
Author Information
  1. B J Anderson: Department of Psychology, State University of New York, Stony Brook, NY 11794-2500, USA. banderso@psych1.psy.sunysb.edu

Abstract

Previous studies indicate that the hippocampus is active during exercise, and that neurotrophin expression, receptor density, and survival of dentate gyrus granule cells in the hippocampus can be modified by moderate voluntary exercise. The present study was designed to test the consequences of voluntary exercise on a hippocampal-related behavior. Exercising and control rats were tested on the standard and delayed nonmatch-to-position (DNMTP) version of the eight-arm radial maze, both of which are sensitive to hippocampal damage. Voluntarily exercising rats ran in running wheels attached to their home cage for 7 weeks prior to and throughout testing, and took 30% fewer trials to acquire criterion performance than sedentary controls. Both groups spent the same average time per arm. Once the eight-arm maze had been learned to criterion, group differences were not apparent. Exercise can facilitate acquisition of a hippocampal-related spatial learning task, but does not affect performance following acquisition. Further work will be necessary to link these effects to hippocampal-related variables shown to be influenced by exercise.

Grants

  1. MH57845/NIMH NIH HHS

MeSH Term

Analysis of Variance
Animals
Female
Hippocampus
Maze Learning
Motor Activity
Rats
Rats, Long-Evans
Reaction Time
Space Perception

Word Cloud

Created with Highcharts 10.0.0exercisehippocampal-relatedmazehippocampuscanvoluntaryratseight-armradialcriterionperformancearmExerciseacquisitionspatiallearningPreviousstudiesindicateactiveneurotrophinexpressionreceptordensitysurvivaldentategyrusgranulecellsmodifiedmoderatepresentstudydesignedtestconsequencesbehaviorExercisingcontroltestedstandarddelayednonmatch-to-positionDNMTPversionsensitivehippocampaldamageVoluntarilyexercisingranrunningwheelsattachedhomecage7weekspriorthroughouttestingtook30%fewertrialsacquiresedentarycontrolsgroupsspentaveragetimeperlearnedgroupdifferencesapparentfacilitatetaskaffectfollowingworkwillnecessarylinkeffectsvariablesshowninfluencedinfluences

Similar Articles

Cited By (58)