The chromomycin CmmA acetyltransferase: a membrane-bound enzyme as a tool for increasing structural diversity of the antitumour mithramycin.

Beatriz García, Javier González-Sabín, Nuria Menéndez, Alfredo F Braña, Luz Elena Núñez, Francisco Morís, José A Salas, Carmen Méndez
Author Information
  1. Beatriz García: Departamento de Biología Funcional e Instituto Universitario de Oncología del Principado de Asturias (I.U.O.P.A), Universidad de Oviedo, Oviedo, Spain.

Abstract

Mithramycin and chromomycin A(3) are two structurally related antitumour compounds, which differ in the glycosylation profiles and functional group substitutions of the sugars. Chromomycin contains two acetyl groups, which are incorporated during the biosynthesis by the acetyltransferase CmmA in Streptomyces griseus ssp. griseus. A bioconversion strategy using an engineered S. griseus strain generated seven novel acetylated mithramycins. The newly formed compounds were purified and characterized by MS and NMR. These new compounds differ from their parental compounds in the presence of one, two or three acetyl groups, attached at 3E, 4E and/or 4D positions. All new mithramycin analogues showed antitumour activity at micromolar of lower concentrations. Some of the compounds showed improved activities against glioblastoma or pancreas tumour cells. The CmmA acetyltransferase was located in the cell membrane and was shown to accept several acyl-CoA substrates. All these results highlight the potential of CmmA as a tool to create structural diversity in these antitumour compounds.

References

  1. J Clin Invest. 1991 Nov;88(5):1613-21 [PMID: 1834700]
  2. Blood. 2003 Aug 15;102(4):1276-81 [PMID: 12738678]
  3. Nature. 1970 Aug 15;227(5259):680-5 [PMID: 5432063]
  4. Anal Biochem. 1976 May 7;72:248-54 [PMID: 942051]
  5. Bioorg Med Chem. 2003 Jul 3;11(13):2791-801 [PMID: 12788353]
  6. Nucleic Acids Res. 2007;35(7):2215-26 [PMID: 17369273]
  7. Biochemistry. 1993 Jul 6;32(26):6588-604 [PMID: 8329387]
  8. Biochemistry. 1993 Jan 19;32(2):463-71 [PMID: 8422355]
  9. J Nat Prod. 1999 Jan;62(1):119-21 [PMID: 9917296]
  10. Cancer Res. 2007 May 15;67(10):4878-85 [PMID: 17510417]
  11. Chem Biol. 2004 Jan;11(1):21-32 [PMID: 15112992]
  12. Appl Environ Microbiol. 1994 Jul;60(7):2657-60 [PMID: 8074537]
  13. J Bacteriol. 1992 Aug;174(15):5141-4 [PMID: 1629172]
  14. Chem Biol. 2009 Oct 30;16(10):1031-44 [PMID: 19875077]
  15. Chembiochem. 2008 Sep 22;9(14):2295-304 [PMID: 18756551]
  16. J Immunol Methods. 1983 Dec 16;65(1-2):55-63 [PMID: 6606682]
  17. J Mol Biol. 1995 Sep 1;251(5):674-89 [PMID: 7666419]
  18. J Am Chem Soc. 2003 May 14;125(19):5745-53 [PMID: 12733914]
  19. J Nat Prod. 2007 Mar;70(3):461-77 [PMID: 17309302]
  20. Appl Environ Microbiol. 2006 Jan;72(1):167-77 [PMID: 16391039]
  21. Mol Microbiol. 2004 Aug;53(3):903-15 [PMID: 15255901]
  22. J Neurosurg. 1999 Jan;90(1):72-7 [PMID: 10413158]
  23. J Nat Prod. 2008 Feb;71(2):199-207 [PMID: 18197601]
  24. Nucleic Acids Res. 2006 Mar 29;34(6):1721-34 [PMID: 16571899]
  25. Biochemistry. 1991 Apr 30;30(17):4290-7 [PMID: 1827033]
  26. J Bacteriol. 1998 Sep;180(18):4929-37 [PMID: 9733697]
  27. Am J Med Sci. 1987 Nov;294(5):388-94 [PMID: 2962490]
  28. Mol Cancer. 2006 Nov 02;5(1):55 [PMID: 17081305]
  29. J Am Chem Soc. 2002 Jun 12;124(23):6544-5 [PMID: 12047169]
  30. Biochemistry. 1997 Feb 25;36(8):2291-9 [PMID: 9047331]
  31. Ann Neurol. 2001 Mar;49(3):345-54 [PMID: 11261509]
  32. Ann Oncol. 2008 Jul;19(7):1224-1230 [PMID: 18381371]
  33. J Clin Invest. 1989 Jun;83(6):2003-7 [PMID: 2542379]
  34. Biopolymers. 2000-2001;56(2):85-95 [PMID: 11592055]
  35. Microbiology (Reading). 2007 Sep;153(Pt 9):3061-3070 [PMID: 17768249]
  36. Anal Biochem. 1981 Apr;112(2):195-203 [PMID: 6266278]

MeSH Term

Acetyltransferases
Antineoplastic Agents
Bacterial Proteins
Biotransformation
Cell Line, Tumor
Cell Membrane
Chromomycins
Humans
Plicamycin
Streptomyces griseus

Chemicals

Antineoplastic Agents
Bacterial Proteins
Chromomycins
Acetyltransferases
Plicamycin

Word Cloud

Created with Highcharts 10.0.0compoundsantitumourCmmAtwogriseuschromomycindifferacetylgroupsacetyltransferasenewmithramycinshowedtoolstructuraldiversityMithramycin3structurallyrelatedglycosylationprofilesfunctionalgroupsubstitutionssugarsChromomycincontainsincorporatedbiosynthesisStreptomycessspbioconversionstrategyusingengineeredSstraingeneratedsevennovelacetylatedmithramycinsnewlyformedpurifiedcharacterizedMSNMRparentalpresenceonethreeattached3E4Eand/or4Dpositionsanaloguesactivitymicromolarlowerconcentrationsimprovedactivitiesglioblastomapancreastumourcellslocatedcellmembraneshownacceptseveralacyl-CoAsubstratesresultshighlightpotentialcreateacetyltransferase:membrane-boundenzymeincreasing

Similar Articles

Cited By