OpenLB
Open Library of Bioscience
Advanced Search
Seminars in cell & developmental biology
Apr, 2012;23 (2): 145-53.

Ras trafficking, localization and compartmentalized signalling.

Ian A Prior, John F Hancock
Author Information
  1. Ian A Prior: Physiological Laboratory, Department of Molecular and Cellular Physiology, Institute of Translational Research, University of Liverpool, Crown St., Liverpool L69 3BX, UK. iprior@liverpool.ac.uk
PMID: 21924373 DOI: 10.1016/j.semcdb.2011.09.002

Abstract

Ras proteins are proto-oncogenes that are frequently mutated in human cancers. Three closely related isoforms, HRAS, KRAS and NRAS, are expressed in all cells and have overlapping but distinctive functions. Recent work has revealed how differences between the Ras isoforms in their trafficking, localization and protein-membrane orientation enable signalling specificity to be determined. We review the various strategies used to characterize compartmentalized Ras localization and signalling. Localization is an important contextual modifier of signalling networks and insights from the Ras system are of widespread relevance for researchers interested in signalling initiated from membranes.

References

  1. Mol Cell Biol. 2000 Apr;20(7):2475-87 [PMID: 10713171]
  2. Prog Lipid Res. 2010 Jul;49(3):250-61 [PMID: 20176053]
  3. J Cell Sci. 2008 Feb 15;121(Pt 4):421-7 [PMID: 18211960]
  4. EMBO Rep. 2006 Jan;7(1):46-51 [PMID: 16282985]
  5. Mol Cell. 2006 Mar 3;21(5):679-87 [PMID: 16507365]
  6. Biochim Biophys Acta. 2007 Aug;1773(8):1177-95 [PMID: 17428555]
  7. Mol Biol Cell. 2008 Mar;19(3):765-75 [PMID: 18094044]
  8. J Cell Biol. 2009 Mar 23;184(6):863-79 [PMID: 19289794]
  9. Carcinogenesis. 2008 Jun;29(6):1157-63 [PMID: 18515281]
  10. Nat Genet. 2010 Jan;42(1):27-9 [PMID: 19966803]
  11. Annu Rev Biophys Biomol Struct. 2005;34:351-78 [PMID: 15869394]
  12. Proc Natl Acad Sci U S A. 2005 Oct 25;102(43):15500-5 [PMID: 16223883]
  13. Science. 2005 Mar 18;307(5716):1746-52 [PMID: 15705808]
  14. Cancer Res. 2008 Aug 15;68(16):6608-16 [PMID: 18701484]
  15. Mol Cell Biol. 2004 Apr;24(8):3485-96 [PMID: 15060167]
  16. Oncogene. 2008 Apr 24;27(19):2754-62 [PMID: 17998936]
  17. Cell Cycle. 2008 Jan 15;7(2):127-34 [PMID: 18212529]
  18. Ciba Found Symp. 1993;176:6-21; discussion 21-7 [PMID: 8299426]
  19. Nat Methods. 2010 Mar;7(3):206-8 [PMID: 20154678]
  20. Cell. 2010 Apr 30;141(3):458-71 [PMID: 20416930]
  21. Biochem J. 2005 Jul 1;389(Pt 1):1-11 [PMID: 15954863]
  22. Annu Rev Biophys Biomol Struct. 2004;33:269-95 [PMID: 15139814]
  23. FEBS Lett. 1998 Dec 11;441(1):34-8 [PMID: 9877160]
  24. J Cell Biol. 2006 Sep 11;174(6):851-62 [PMID: 16954349]
  25. Nat Rev Mol Cell Biol. 2010 Jun;11(6):414-26 [PMID: 20495582]
  26. J Biol Chem. 2003 Aug 29;278(35):33465-73 [PMID: 12782630]
  27. J Biol Chem. 2001 May 11;276(19):15609-15 [PMID: 11278702]
  28. Nat Cell Biol. 2007 Aug;9(8):905-14 [PMID: 17618274]
  29. Mol Cell Biol. 2004 Feb;24(4):1516-30 [PMID: 14749369]
  30. J Med Chem. 2007 Feb 22;50(4):674-84 [PMID: 17263520]
  31. Nat Rev Cancer. 2003 Jun;3(6):459-65 [PMID: 12778136]
  32. PLoS One. 2010 Jan 21;5(1):e8811 [PMID: 20098676]
  33. Oncogene. 1997 Sep 4;15(10):1151-9 [PMID: 9294608]
  34. J Cell Physiol. 2007 Mar;210(3):740-9 [PMID: 17133351]
  35. J Cell Biol. 2004 Nov 8;167(3):505-18 [PMID: 15534002]
  36. Mol Cell Biol. 2002 Jul;22(14):5128-40 [PMID: 12077341]
  37. Proc Natl Acad Sci U S A. 2011 May 10;108(19):7763-8 [PMID: 21512128]
  38. Proc Natl Acad Sci U S A. 2010 Jan 12;107(2):726-31 [PMID: 20080742]
  39. Mol Cell Biol. 2004 Jun;24(11):4943-54 [PMID: 15143186]
  40. Dev Cell. 2004 Jul;7(1):33-44 [PMID: 15239952]
  41. J Cell Biol. 2002 May 27;157(5):865-72 [PMID: 12021258]
  42. Mol Cell Biol. 2011 Oct;31(19):3938-52 [PMID: 21807892]
  43. J Am Chem Soc. 2007 Oct 10;129(40):12280-6 [PMID: 17880077]
  44. Nat Cell Biol. 2002 May;4(5):343-50 [PMID: 11988737]
  45. Curr Opin Genet Dev. 2009 Jun;19(3):230-6 [PMID: 19467855]
  46. Dev Cell. 2010 May 18;18(5):737-49 [PMID: 20493808]
  47. Biochim Biophys Acta. 2008 Feb;1778(2):466-71 [PMID: 18068112]
  48. Mol Biol Cell. 2008 Nov;19(11):4776-84 [PMID: 18784252]
  49. Science. 2006 Jul 21;313(5785):347-51 [PMID: 16857939]
  50. J Immunol. 2010 Sep 15;185(6):3536-43 [PMID: 20713885]
  51. J Biol Chem. 2009 Oct 9;284(41):28410-28419 [PMID: 19661056]
  52. Cell. 2004 Feb 20;116(4):577-89 [PMID: 14980224]
  53. J Cell Biol. 2005 Jul 18;170(2):261-72 [PMID: 16027222]
  54. Nat Cell Biol. 2010 Mar;12(3):267-72 [PMID: 20118922]
  55. Mol Cell Biol. 2005 Aug;25(15):6722-33 [PMID: 16024806]
  56. J Biol Chem. 2010 Nov 5;285(45):35188-95 [PMID: 20826816]
  57. Nucleic Acids Res. 2011 Jan;39(Database issue):D945-50 [PMID: 20952405]
  58. Mol Biol Cell. 2008 Apr;19(4):1404-14 [PMID: 18234837]
  59. Biochim Biophys Acta. 2009 Jan;1788(1):273-88 [PMID: 18771652]
  60. Nat Genet. 2008 May;40(5):600-8 [PMID: 18372904]
  61. Mol Cell Biol. 2004 Aug;24(15):6799-810 [PMID: 15254246]
  62. J Cell Biol. 2003 Jan 20;160(2):165-70 [PMID: 12527752]
  63. Neuron. 2001 Dec 6;32(5):801-14 [PMID: 11738027]
  64. J Cell Biol. 2010 Oct 4;191(1):23-9 [PMID: 20876282]
  65. Cell Mol Life Sci. 2007 Oct;64(19-20):2575-89 [PMID: 17628742]
  66. Sci Signal. 2010 Sep 21;3(140):ra68 [PMID: 20858867]
  67. Eukaryot Cell. 2009 Feb;8(2):181-9 [PMID: 19098128]
  68. Integr Biol (Camb). 2010 Apr;2(4):202-8 [PMID: 20473400]
  69. Cell Signal. 2008 Aug;20(8):1415-22 [PMID: 18385017]
  70. Traffic. 2004 Apr;5(4):231-40 [PMID: 15030564]
  71. Cell. 1985 Jan;40(1):27-36 [PMID: 2981630]
  72. Mol Cell Biol. 2006 Jan;26(1):100-16 [PMID: 16354683]
  73. Semin Cell Dev Biol. 2007 Oct;18(5):599-607 [PMID: 17897845]
  74. Mol Cell Biol. 2006 Oct;26(19):7190-200 [PMID: 16980621]
  75. Cell. 1999 Jul 9;98(1):69-80 [PMID: 10412982]
  76. Mol Cell Biol. 2008 Jul;28(13):4377-85 [PMID: 18458061]
  77. Mol Cell Biol. 2010 Jul;30(14):3553-68 [PMID: 20457808]
  78. Mol Cell. 2006 Feb 17;21(4):481-93 [PMID: 16483930]
  79. Nat Chem Biol. 2010 Jun;6(6):449-56 [PMID: 20418879]
  80. J Biol Chem. 1998 Sep 11;273(37):24052-6 [PMID: 9727023]
  81. Biophys J. 2010 Jul 21;99(2):534-43 [PMID: 20643072]
  82. Cell Cycle. 2006 Sep;5(17):1936-9 [PMID: 16931912]
  83. Proc Natl Acad Sci U S A. 2006 Nov 7;103(45):16692-7 [PMID: 17075039]
  84. Curr Biol. 2001 Nov 27;11(23):1880-4 [PMID: 11728312]
  85. Cell. 2007 Jun 1;129(5):865-77 [PMID: 17540168]
  86. EMBO J. 1994 Sep 15;13(18):4269-77 [PMID: 7925272]
  87. Trends Cell Biol. 2008 Aug;18(8):364-71 [PMID: 18620858]
  88. Cell Cycle. 2008 May 15;7(10):1332-5 [PMID: 18418066]
  89. Adv Exp Med Biol. 1988;234:213-24 [PMID: 3063087]
  90. Science. 1998 May 15;280(5366):1082-6 [PMID: 9582122]
  91. Biochim Biophys Acta. 2006 Oct;1763(10):1108-24 [PMID: 16996152]
  92. Proc Natl Acad Sci U S A. 2007 Sep 4;104(36):14348-53 [PMID: 17724343]
  93. Biophys J. 2004 Jun;86(6):4075-93 [PMID: 15189902]
  94. Biochim Biophys Acta. 2011 Feb;1813(2):298-307 [PMID: 21145357]
  95. Cell Cycle. 2008 Sep 1;7(17):2667-73 [PMID: 18758236]
  96. Science. 1996 Dec 20;274(5295):2086-9 [PMID: 8953040]
  97. Mol Cell Biol. 2011 Mar;31(5):983-97 [PMID: 21189290]
  98. Nat Cell Biol. 2007 Jan;9(1):7-14 [PMID: 17199125]
  99. Angew Chem Int Ed Engl. 2009;48(46):8784-7 [PMID: 19830755]
  100. EMBO J. 2008 Mar 5;27(5):727-35 [PMID: 18273062]
  101. Nat Cell Biol. 2007 Jun;9(6):713-9 [PMID: 17486117]
  102. Cancer Res. 2011 Mar 15;71(6):2140-51 [PMID: 21257709]
  103. Nature. 2003 Aug 7;424(6949):694-8 [PMID: 12845332]
  104. Cell. 1990 Oct 5;63(1):133-9 [PMID: 2208277]
  105. Biophys J. 2007 Oct 15;93(8):2697-712 [PMID: 17557790]
  106. Proc Natl Acad Sci U S A. 2010 Jan 19;107(3):1130-5 [PMID: 20080631]
  107. Cell. 2008 Dec 12;135(6):1085-97 [PMID: 19070578]
  108. Proc Natl Acad Sci U S A. 2004 May 11;101(19):7317-22 [PMID: 15123831]
  109. Curr Opin Microbiol. 2010 Dec;13(6):677-83 [PMID: 20880736]
  110. Nat Cell Biol. 2001 Apr;3(4):368-75 [PMID: 11283610]
  111. Proc Natl Acad Sci U S A. 2006 Jun 13;103(24):9045-50 [PMID: 16754851]
  112. Mol Biol Cell. 2006 Jan;17(1):192-202 [PMID: 16236799]
  113. J Biol Chem. 2005 Oct 14;280(41):34997-5010 [PMID: 16079139]
  114. J Cell Biol. 2005 Aug 1;170(3):429-41 [PMID: 16043511]
  115. Nat Rev Mol Cell Biol. 2006 Jun;7(6):456-62 [PMID: 16625153]

Grants

  1. BB/G018162/1/Biotechnology and Biological Sciences Research Council
  2. R01 GM066717/NIGMS NIH HHS
  3. 085201/Wellcome Trust
  4. /Wellcome Trust
  5. GM066717/NIGMS NIH HHS

MeSH Term

Amino Acid Sequence
Animals
Cell Compartmentation
Cell Membrane
Endoplasmic Reticulum
Endosomes
Enzyme Activation
Evolution, Molecular
Golgi Apparatus
Humans
Molecular Sequence Data
Protein Isoforms
Protein Structure, Tertiary
Protein Transport
Signal Transduction
ras Proteins

Chemicals

Protein Isoforms
ras Proteins
Journal Article Research Support, N.I.H., Extramural Research Support, Non-U.S. Gov't Review
Article has an altmetric score of 9

Word Cloud

Created with Highcharts 10.0.0Rassignallinglocalizationisoformstraffickingcompartmentalizedproteinsproto-oncogenesfrequentlymutatedhumancancersThreecloselyrelatedHRASKRASNRASexpressedcellsoverlappingdistinctivefunctionsRecentworkrevealeddifferencesprotein-membraneorientationenablespecificitydeterminedreviewvariousstrategiesusedcharacterizeLocalizationimportantcontextualmodifiernetworksinsightssystemwidespreadrelevanceresearchersinterestedinitiatedmembranes

Similar Articles

Cited By