Evaluation of gamma interferon and antibody tuberculosis tests in alpacas.

Shelley Rhodes, Tom Holder, Derek Clifford, Ian Dexter, Jacky Brewer, Noel Smith, Laura Waring, Tim Crawshaw, Steve Gillgan, Konstantin Lyashchenko, John Lawrence, John Clarke, Ricardo de la Rua-Domenech, Martin Vordermeier
Author Information
  1. Shelley Rhodes: Animal Health and Veterinary Laboratories Agency-Weybridge, Addlestone, Surrey, United Kingdom. Shelley.Rhodes@ahvla.gsi.gov.uk

Abstract

We describe the performance of cell-based and antibody blood tests for the antemortem diagnosis of tuberculosis (TB) in South American camelids (SAC). The sensitivity and specificity of the gamma interferon (IFN-γ) release assay, two lateral flow rapid antibody tests (Stat-Pak and Dual Path Platform [DPP]), and two enzyme-linked immunosorbent assay (ELISA)-based antibody tests (Idexx and Enferplex) were determined using diseased alpacas from Mycobacterium bovis culture-confirmed breakdown herds and TB-free alpacas from geographical areas with no history of bovine TB, respectively. Our results show that while the sensitivities of the IFN-γ and antibody tests were similar (range of 57.7% to 66.7%), the specificity of the IFN-γ test (89.1%) was lower than those of any of the antibody tests (range of 96.4% to 97.4%). This lower specificity of the IFN-γ test was at least in part due to undisclosed Mycobacterium microti infection in the TB-free cohort, which stimulates a positive purified protein derivative (PPD) response. The sensitivity of infection detection could be increased by combining two antibody tests, but even the use of all four antibody tests failed to detect all diseased alpacas. These antibody-negative alpacas were IFN-γ positive. We found that the maximum sensitivity could be achieved only by the combination of the IFN-γ test with two antibody tests in a "test package," although this resulted in decreased specificity. The data from this evaluation of tests with defined sensitivity and specificity provide potential options for antemortem screening of SAC for TB in herd breakdown situations and could also find application in movement testing and tracing investigations.

References

  1. Clin Vaccine Immunol. 2011 Dec;18(12):2143-7 [PMID: 22012976]
  2. Clin Vaccine Immunol. 2007 Sep;14(9):1203-9 [PMID: 17671227]
  3. Emerg Infect Dis. 2000 Sep-Oct;6(5):539-42 [PMID: 10998387]
  4. J Clin Microbiol. 2010 May;48(5):1960-4 [PMID: 20237097]
  5. Vet Microbiol. 2007 May 16;122(1-2):108-15 [PMID: 17317042]
  6. Clin Diagn Lab Immunol. 2001 May;8(3):571-8 [PMID: 11329460]
  7. Tuberculosis (Edinb). 2001;81(1-2):147-55 [PMID: 11463236]
  8. Acta Zool Pathol Antverp. 1970 Sep;51:17-24 [PMID: 5527701]
  9. J Vet Intern Med. 2009 Nov-Dec;23(6):1266-72 [PMID: 19709353]
  10. Vet Microbiol. 1994 May;40(1-2):125-35 [PMID: 8073620]
  11. Lancet. 2001 Jun 23;357(9273):2017-21 [PMID: 11438135]
  12. Transbound Emerg Dis. 2012 Feb;59(1):1-10 [PMID: 21635699]
  13. Clin Vaccine Immunol. 2011 Nov;18(11):1882-8 [PMID: 21918115]
  14. Emerg Infect Dis. 2007 Dec;13(12):1924-7 [PMID: 18258049]
  15. Vet Rec. 2009 Sep 12;165(11):323-4 [PMID: 19749210]
  16. Vet Immunol Immunopathol. 2011 Nov 15;144(1-2):129-34 [PMID: 21906820]
  17. Vet Microbiol. 2007 Dec 15;125(3-4):265-73 [PMID: 17628360]
  18. J Med Microbiol. 2010 Aug;59(Pt 8):984-989 [PMID: 20488936]
  19. J Clin Microbiol. 2009 Aug;47(8):2551-9 [PMID: 19535520]
  20. Clin Vaccine Immunol. 2008 Dec;15(12):1834-8 [PMID: 18927068]
  21. Clin Vaccine Immunol. 2009 Aug;16(8):1196-202 [PMID: 19571108]
  22. Int J Tuberc Lung Dis. 1998 Jun;2(6):443-50 [PMID: 9626600]
  23. Clin Vaccine Immunol. 2010 Feb;17(2):247-52 [PMID: 20007361]
  24. Vet Rec. 1999 Nov 27;145(22):639-40 [PMID: 10619610]
  25. J Clin Microbiol. 2004 Apr;42(4):1818-21 [PMID: 15071059]
  26. Clin Vaccine Immunol. 2009 May;16(5):605-12 [PMID: 19261770]

MeSH Term

Animals
Antibodies, Bacterial
Antigens, Bacterial
Camelids, New World
Enzyme-Linked Immunosorbent Assay
Interferon-gamma
Mycobacterium bovis
Sensitivity and Specificity
Serologic Tests
Tuberculin
Tuberculin Test
Tuberculosis

Chemicals

Antibodies, Bacterial
Antigens, Bacterial
Tuberculin
Interferon-gamma

Word Cloud

Created with Highcharts 10.0.0testsantibodyIFN-γspecificityalpacassensitivitytwoTBtestantemortemtuberculosisSACgammainterferonassaydiseasedMycobacteriumbreakdownTB-freerange7%lower4%infectionpositivedescribeperformancecell-basedblooddiagnosisSouthAmericancamelidsreleaselateralflowrapidStat-PakDualPathPlatform[DPP]enzyme-linkedimmunosorbentELISA-basedIdexxEnferplexdeterminedusingbovisculture-confirmedherdsgeographicalareashistorybovinerespectivelyresultsshowsensitivitiessimilar5766891%9697leastpartdueundisclosedmicroticohortstimulatespurifiedproteinderivativePPDresponsedetectionincreasedcombiningevenusefourfaileddetectantibody-negativefoundmaximumachievedcombination"testpackage"althoughresulteddecreaseddataevaluationdefinedprovidepotentialoptionsscreeningherdsituationsalsofindapplicationmovementtestingtracinginvestigationsEvaluation

Similar Articles

Cited By