Evidence of long-lived founder virus in mother-to-child HIV transmission.

Sivapragashini Danaviah, Tulio de Oliveira, Ruth Bland, Johannes Viljoen, Sureshnee Pillay, Edouard Tuaillon, Philippe Van de Perre, Marie-Louise Newell
Author Information
  1. Sivapragashini Danaviah: Africa Centre for Health and Population Studies, University of KwaZulu-Natal, Durban, South Africa.
  2. Tulio de Oliveira: Africa Centre for Health and Population Studies, University of KwaZulu-Natal, Durban, South Africa.
  3. Ruth Bland: Africa Centre for Health and Population Studies, University of KwaZulu-Natal, Durban, South Africa; Royal Hospital for Sick Children, Glasgow, United Kingdom.
  4. Johannes Viljoen: Africa Centre for Health and Population Studies, University of KwaZulu-Natal, Durban, South Africa; Université Montpellier 1, 34090, Montpellier, France.
  5. Sureshnee Pillay: Africa Centre for Health and Population Studies, University of KwaZulu-Natal, Durban, South Africa.
  6. Edouard Tuaillon: Université Montpellier 1, 34090, Montpellier, France; Centre Hospitalier Universitaire de Montpellier, Département de Bactériologie-Virologie, Institut de Recherche en Biothérapie and Department of Medical Information, 34295, Montpellier, France.
  7. Philippe Van de Perre: Université Montpellier 1, 34090, Montpellier, France; Centre Hospitalier Universitaire de Montpellier, Département de Bactériologie-Virologie, Institut de Recherche en Biothérapie and Department of Medical Information, 34295, Montpellier, France.
  8. Marie-Louise Newell: Africa Centre for Health and Population Studies, University of KwaZulu-Natal, Durban, South Africa; Faculty of Medicine, University of Southampton, Southampton, United Kingdom.

Abstract

Exposure of the infant's gut to cell-associated and cell-free HIV-1 trafficking in breast milk (BM) remains a primary cause of mother-to-child transmission (MTCT). The mammary gland represents a unique environment for HIV-1 replication and host-virus interplay. We aimed to explore the origin of the virus transmitted during breastfeeding, and the link with quasi-species found in acellular and cellular fractions of breast-milk (BM) and in maternal plasma. The C2-V5 region of the env gene was amplified, cloned and sequenced from the RNA and DNA of BM, the RNA from the mother's plasma (PLA) and the DNA from infant's dried blood spot (DBS) in 11 post-natal mother-infant pairs. Sequences were assembled in Geneious, aligned in ClustalX, manually edited in SeAL and phylogenetic reconstruction was undertaken in PhyML and MrBayes. We estimated the timing of transmission (ETT) and reconstructed the time for the most recent common ancestor (TMRCA) of the infant in BEAST. Transmission of single quasi-species was observed in 9 of 11 cases. Phylogenetic analysis illustrated a BM transmission event by cell-free virus in 4 cases, and by cell-associated virus in 2 cases but could not be identified in the remaining 5 cases. Molecular clock estimates, of the infant ETT and TMRCA, corresponded well with the timing of transmission estimated by sequential infant DNA PCR in 10 of 11 children. The TMRCA of BM variants were estimated to emerge during gestation in 8 cases. We hypothesize that in the remaining cases, the breast was seeded with a long-lived lineage latently infecting resting T-cells. Our analysis illustrated the role of DNA and RNA virus in MTCT. We postulate that DNA archived viruses stem from latently infected quiescent T-cells within breast tissue and MTCT can be expected to continue, albeit at low levels, should interventions not effectively target these cells.

Associated Data

GENBANK | KP261088; KP261089; KP261090; KP261091; KP261092; KP261093; KP261094; KP261095; KP261096; KP261097; KP261098; KP261099; KP261100; KP261101; KP261102; KP261103; KP261104; KP261105; KP261106; KP261107; KP261108; KP261109; KP261110; KP261111; KP261112; KP261113; KP261114; KP261115; KP261116; KP261117; KP261118; KP261119; KP261120; KP261121; KP261122; KP261123; KP261124; KP261125; KP261126; KP261127; KP261128; KP261129; KP261130; KP261131; KP261132; KP261133; KP261134; KP261135; KP261136; KP261137; KP261138; KP261139; KP261140; KP261141; KP261142; KP261143; KP261144; KP261145; KP261146; KP261147; KP261148; KP261149; KP261150; KP261151; KP261152; KP261153; KP261154; KP261155; KP261156; KP261157; KP261158; KP261159; KP261160; KP261161; KP261162; KP261163; KP261164; KP261165; KP261166; KP261167; KP261168; KP261169; KP261170; KP261171; KP261172; KP261173; KP261174; KP261175; KP261176; KP261177; KP261178; KP261179; KP261180; KP261181; KP261182; KP261183; KP261184; KP261185; KP261186; KP261187; KP261188; KP261189; KP261190; KP261191; KP261192; KP261193; KP261194; KP261195; KP261196; KP261197; KP261198; KP261199; KP261200; KP261201; KP261202; KP261203; KP261204; KP261205; KP261206; KP261207; KP261208; KP261209; KP261210; KP261211; KP261212; KP261213; KP261214; KP261215; KP261216; KP261217; KP261218; KP261219; KP261220; KP261221; KP261222; KP261223; KP261224; KP261225; KP261226; KP261227; KP261228; KP261229; KP261230; KP261231; KP261232; KP261233; KP261234; KP261235; KP261236; KP261237; KP261238; KP261239; KP261240; KP261241; KP261242; KP261243; KP261244; KP261245; KP261246; KP261247; KP261248; KP261249; KP261250; KP261251; KP261252; KP261253; KP261254; KP261255; KP261256; KP261257; KP261258; KP261259; KP261260; KP261261; KP261262; KP261263; KP261264; KP261265; KP261266; KP261267; KP261268; KP261269; KP261270; KP261271; KP261272; KP261273; KP261274; KP261275; KP261276; KP261277; KP261278; KP261279; KP261280; KP261281; KP261282; KP261283; KP261284; KP261285; KP261286; KP261287; KP261288; KP261289; KP261290; KP261291; KP261292; KP261293; KP261294; KP261295; KP261296; KP261297; KP261298; KP261299; KP261300; KP261301; KP261302; KP261303; KP261304; KP261305; KP261306; KP261307; KP261308; KP261309; KP261310; KP261311; KP261312; KP261313; KP261314; KP261315; KP261316; KP261317; KP261318; KP261319; KP261320; KP261321; KP261322; KP261323; KP261324; KP261325; KP261326; KP261327; KP261328; KP261329; KP261330; KP261331; KP261332; KP261333; KP261334; KP261335; KP261336; KP261337; KP261338; KP261339; KP261340; KP261341; KP261342; KP261343; KP261344; KP261345; KP261346; KP261347; KP261348; KP261349; KP261350; KP261351; KP261352; KP261353; KP261354; KP261355; KP261356; KP261357; KP261358; KP261359; KP261360; KP261361; KP261362; KP261363; KP261364; KP261365; KP261366; KP261367; KP261368; KP261369; KP261370; KP261371; KP261372; KP261373; KP261374; KP261375; KP261376; KP261377; KP261378; KP261379; KP261380; KP261381; KP261382; KP261383; KP261384; KP261385; KP261386; KP261387; KP261388; KP261389; KP261390; KP261391; KP261392; KP261393; KP261394; KP261395; KP261396; KP261397; KP261398; KP261399; KP261400; KP261401; KP261402; KP261403; KP261404; KP261405; KP261406; KP261407; KP261408; KP261409; KP261410; KP261411; KP261412; KP261413; KP261414; KP261415; KP261416; KP261417; KP261418; KP261419; KP261420; KP261421; KP261422; KP261423; KP261424; KP261425; KP261426; KP261427; KP261428; KP261429; KP261430; KP261431; KP261432; KP261433; KP261434; KP261435; KP261436; KP261437; KP261438; KP261439; KP261440; KP261441; KP261442; KP261443; KP261444; KP261445; KP261446; KP261447; KP261448; KP261449; KP261450; KP261451; KP261452; KP261453; KP261454; KP261455; KP261456; KP261457; KP261458; KP261459; KP261460; KP261461; KP261462; KP261463; KP261464; KP261465; KP261466; KP261467; KP261468; KP261469; KP261470; KP261471; KP261472; KP261473; KP261474; KP261475; KP261476; KP261477; KP261478; KP261479; KP261480; KP261481; KP261482; KP261483; KP261484; KP261485; KP261486; KP261487; KP261488; KP261489; KP261490; KP261491; KP261492; KP261493; KP261494; KP261495; KP261496; KP261497; KP261498; KP261499; KP261500; KP261501; KP261502; KP261503; KP261504; KP261505; KP261506; KP261507; KP261508; KP261509; KP261510; KP261511; KP261512; KP261513; KP261514; KP261515; KP261516; KP261517; KP261518; KP261519; KP261520; KP261521; KP261522; KP261523; KP261524; KP261525; KP261526; KP261527; KP261528; KP261529; KP261530; KP261531; KP261532; KP261533; KP261534; KP261535; KP261536; KP261537; KP261538; KP261539; KP261540; KP261541; KP261542; KP261543; KP261544; KP261545; KP261546; KP261547; KP261548; KP261549; KP261550; KP261551; KP261552; KP261553; KP261554; KP261555; KP261556; KP261557; KP261558; KP261559; KP261560; KP261561; KP261562; KP261563; KP261564; KP261565; KP261566; KP261567; KP261568; KP261569; KP261570; KP261571; KP261572; KP261573; KP261574; KP261575; KP261576; KP261577; KP261578; KP261579; KP261580; KP261581; KP261582; KP261583; KP261584; KP261585; KP261586; KP261587; KP261588; KP261589; KP261590; KP261591; KP261592; KP261593; KP261594; KP261595; KP261596; KP261597; KP261598; KP261599; KP261600; KP261601; KP261602; KP261603; KP261604; KP261605; KP261606; KP261607; KP261608; KP261609; KP261610; KP261611; KP261612; KP261613; KP261614; KP261615; KP261616; KP261617; KP261618; KP261619; KP261620; KP261621; KP261622; KP261623; KP261624; KP261625; KP261626; KP261627; KP261628; KP261629; KP261630; KP261631; KP261632; KP261633; KP261634; KP261635; KP261636; KP261637; KP261638; KP261639; KP261640; KP261641; KP261642; KP261643; KP261644; KP261645; KP261646; KP261647; KP261648; KP261649; KP261650; KP261651; KP261652; KP261653; KP261654; KP261655; KP261656; KP261657; KP261658; KP261659; KP261660; KP261661; KP261662; KP261663; KP261664; KP261665; KP261666; KP261667; KP261668; KP261669; KP261670; KP261671; KP261672; KP261673; KP261674; KP261675; KP261676; KP261677; KP261678; KP261679; KP261680; KP261681; KP261682; KP261683; KP261684; KP261685; KP261686; KP261687; KP261688; KP261689; KP261690; KP261691; KP261692; KP261693; KP261694; KP261695; KP261696; KP261697; KP261698; KP261699; KP261700; KP261701; KP261702; KP261703; KP261704; KP261705; KP261706; KP261707; KP261708; KP261709; KP261710; KP261711; KP261712; KP261713; KP261714; KP261715; KP261716; KP261717; KP261718; KP261719; KP261720; KP261721; KP261722; KP261723; KP261724; KP261725; KP261726; KP261727; KP261728; KP261729; KP261730; KP261731; KP261732; KP261733; KP261734; KP261735; KP261736; KP261737; KP261738; KP261739; KP261740; KP261741; KP261742; KP261743; KP261744; KP261745; KP261746; KP261747; KP261748; KP261749; KP261750; KP261751; KP261752; KP261753; KP261754; KP261755; KP261756; KP261757; KP261758; KP261759; KP261760; KP261761; KP261762; KP261763; KP261764; KP261765; KP261766; KP261767; KP261768; KP261769; KP261770; KP261771; KP261772; KP261773; KP261774; KP261775; KP261776; KP261777; KP261778; KP261779; KP261780; KP261781; KP261782; KP261783; KP261784; KP261785; KP261786; KP261787; KP261788; KP261789; KP261790; KP261791; KP261792; KP261793; KP261794; KP261795; KP261796; KP261797; KP261798; KP261799; KP261800; KP261801; KP261802; KP261803; KP261804; KP261805; KP261806; KP261807; KP261808; KP261809; KP261810; KP261811; KP261812; KP261813; KP261814; KP261815; KP261816; KP261817; KP261818; KP261819; KP261820

References

  1. Retrovirology. 2011;8:34 [PMID: 21569457]
  2. AIDS. 2004 Oct 21;18(15):2096-8 [PMID: 15577636]
  3. J Infect Dis. 2004 Nov 15;190(10):1880-8 [PMID: 15499546]
  4. Syst Biol. 2012 May;61(3):539-42 [PMID: 22357727]
  5. Bioinformatics. 2013 Mar 1;29(5):561-70 [PMID: 23329414]
  6. PLoS One. 2014;9(4):e90421 [PMID: 24717647]
  7. Lancet. 2007 Mar 31;369(9567):1107-16 [PMID: 17398310]
  8. Breastfeed Med. 2007 Jun;2(2):83-91 [PMID: 17661579]
  9. J Virol. 2011 Mar;85(6):2751-63 [PMID: 21191008]
  10. Sci Transl Med. 2012 Jul 18;4(143):143sr3 [PMID: 22814853]
  11. J Virol. 2003 Feb;77(4):2587-99 [PMID: 12551997]
  12. Proc Natl Acad Sci U S A. 2008 May 27;105(21):7552-7 [PMID: 18490657]
  13. PLoS One. 2012;7(12):e51493 [PMID: 23284701]
  14. J Infect Dis. 2010 Jun 1;201(11):1697-702 [PMID: 20423223]
  15. J Virol. 2009 Apr;83(8):3556-67 [PMID: 19193811]
  16. AIDS Res Hum Retroviruses. 2012 Aug;28(8):885-93 [PMID: 22206228]
  17. J Acquir Immune Defic Syndr. 2006 Jan 1;41(1):93-9 [PMID: 16340480]
  18. J Pediatr. 2010 Feb;156(2 Suppl):S8-15 [PMID: 20105666]
  19. Syst Biol. 2004 Oct;53(5):793-808 [PMID: 15545256]
  20. J Vis Exp. 2014;(85). doi: 10.3791/51242 [PMID: 24747156]
  21. Infect Genet Evol. 2013 Oct;19:337-48 [PMID: 23660484]
  22. J Infect Dis. 2005 Sep 1;192(5):713-9 [PMID: 16088820]
  23. AIDS. 2011 Jan 14;25(2):143-52 [PMID: 21173592]
  24. AIDS Res Ther. 2014 Jan 20;11(1):3 [PMID: 24444369]
  25. J Virol. 2010 Oct;84(20):10812-9 [PMID: 20660189]
  26. Virology. 2007 Jul 5;363(2):256-60 [PMID: 17335864]
  27. Nucleic Acids Res. 1994 Nov 11;22(22):4673-80 [PMID: 7984417]
  28. J Virol Methods. 2010 Sep;168(1-2):114-20 [PMID: 20451557]
  29. Clin Infect Dis. 2007 Dec 1;45(11):1502-10 [PMID: 17990235]
  30. Syst Biol. 2010 May;59(3):307-21 [PMID: 20525638]
  31. BMC Evol Biol. 2007;7:214 [PMID: 17996036]
  32. Int J Epidemiol. 2010 Apr;39(2):351-60 [PMID: 19336438]
  33. Clin Infect Dis. 2011 Mar 15;52(6):819-25 [PMID: 21367736]

Grants

  1. /Wellcome Trust
  2. 097410/Wellcome Trust

MeSH Term

Breast Feeding
Female
Genes, env
Genetic Variation
HIV Infections
HIV-1
Humans
Infant
Infant, Newborn
Infectious Disease Transmission, Vertical
Milk, Human
Molecular Sequence Data
Sequence Analysis, DNA
South Africa
Viral Load

Word Cloud

Created with Highcharts 10.0.0casesBMtransmissionvirusDNAbreastMTCTRNA11estimatedTMRCAinfantinfant'scell-associatedcell-freeHIV-1mother-to-childquasi-speciesplasmatimingETTanalysisillustratedremaininglong-livedlatentlyT-cellsExposureguttraffickingmilkremainsprimarycausemammaryglandrepresentsuniqueenvironmentreplicationhost-virusinterplayaimedexploreorigintransmittedbreastfeedinglinkfoundacellularcellularfractionsbreast-milkmaternalC2-V5regionenvgeneamplifiedclonedsequencedmother'sPLAdriedbloodspotDBSpost-natalmother-infantpairsSequencesassembledGeneiousalignedClustalXmanuallyeditedSeALphylogeneticreconstructionundertakenPhyMLMrBayesreconstructedtimerecentcommonancestorBEASTTransmissionsingleobserved9Phylogeneticevent42identified5MolecularclockestimatescorrespondedwellsequentialPCR10childrenvariantsemergegestation8hypothesizeseededlineageinfectingrestingrolepostulatearchivedvirusessteminfectedquiescentwithintissuecanexpectedcontinuealbeitlowlevelsinterventionseffectivelytargetcellsEvidencefounderHIV

Similar Articles

Cited By