A Microfluidic Love-Wave Biosensing Device for PSA Detection Based on an Aptamer Beacon Probe.

Feng Zhang, Shuangming Li, Kang Cao, Pengjuan Wang, Yan Su, Xinhua Zhu, Ying Wan
Author Information
  1. Feng Zhang: School of Mechanical Engineering, Nanjing University of Science and Technology, Nanjing 210094, China. zhangfeng_njust@163.com.
  2. Shuangming Li: School of Mechanical Engineering, Nanjing University of Science and Technology, Nanjing 210094, China. lishuangming1989@163.com.
  3. Kang Cao: School of Mechanical Engineering, Nanjing University of Science and Technology, Nanjing 210094, China. caokang666@163.com.
  4. Pengjuan Wang: School of Environmental and Biological Engineering, Nanjing University of Science and Technology, Nanjing 210094, China. wpjshirley@163.com.
  5. Yan Su: School of Mechanical Engineering, Nanjing University of Science and Technology, Nanjing 210094, China. suyan@njust.edu.cn.
  6. Xinhua Zhu: School of Mechanical Engineering, Nanjing University of Science and Technology, Nanjing 210094, China. zhuxinhua@njust.edu.cn.
  7. Ying Wan: School of Mechanical Engineering, Nanjing University of Science and Technology, Nanjing 210094, China. wanying@njust.edu.cn.

Abstract

A label-free and selective Aptamer beacon-based Love-wave biosensing device was developed for prostate specific antigen (PSA) detection. The device consists of the following parts: LiTaO3 substrate with SiO2 film as wave guide layer, two set of inter-digital transducers (IDT), gold film for immobilization of the biorecongniton layer and a polydimethylsiloxane (PDMS) microfluidic channels. DNA Aptamer, or "artificial antibody", was used as the specific biorecognition probe for PSA capture. Some nucleotides were added to the 3'-end of the Aptamer to form a duplex with the 3'-end, turning the Aptamer into an Aptamer-beacon. Taking advantage of the selective target-induced assembly changes arising from the "Aptamer beacon", highly selective and specific detection of PSA was achieved. Furthermore, PDMS microfluidic channels were designed and fabricated to realize automated quantitative sample injection. After optimization of the experimental conditions, the established device showed good performance for PSA detection between 10 ng/mL to 1 μg/mL, with a detection limit of 10 ng/mL. The proposed sensor might be a promising alternative for point of care diagnostics.

Keywords

References

  1. Biosens Bioelectron. 2014 Oct 15;60:318-24 [PMID: 24836014]
  2. Proteomics. 2003 Mar;3(3):243-8 [PMID: 12627376]
  3. Anal Biochem. 2001 Jul 15;294(2):126-31 [PMID: 11444807]
  4. ACS Nano. 2009 Mar 24;3(3):585-94 [PMID: 19216571]
  5. Anal Chem. 1996 Jan 1;68(1):18-22 [PMID: 8779431]
  6. Anal Chim Acta. 2007 Nov 12;603(2):119-28 [PMID: 17963831]
  7. Small. 2008 Aug;4(8):1196-200 [PMID: 18651718]
  8. Sensors (Basel). 2010;10(6):5859-71 [PMID: 22219691]
  9. Biosens Bioelectron. 2004 Mar 15;19(8):849-59 [PMID: 15128104]
  10. Proteome Sci. 2014 Oct 14;12(1):52 [PMID: 25328446]
  11. J Immunoassay. 2000 May-Aug;21(2-3):165-209 [PMID: 10929886]
  12. Chem Commun (Camb). 2012 Feb 25;48(17):2304-6 [PMID: 22266737]
  13. Biosens Bioelectron. 2011 Dec 15;30(1):93-9 [PMID: 21944923]
  14. IEEE Trans Ultrason Ferroelectr Freq Control. 2001 Jan;48(1):268-73 [PMID: 11367794]
  15. Biosens Bioelectron. 2014 May 15;55:231-6 [PMID: 24384265]
  16. Nano Lett. 2007 Oct;7(10):3065-70 [PMID: 17854227]
  17. Anal Bioanal Chem. 2008 Jul;391(5):1509-19 [PMID: 18265962]
  18. Cancer Res. 2004 Nov 1;64(21):7668-72 [PMID: 15520166]
  19. Sensors (Basel). 2014;14(7):12658-69 [PMID: 25029282]
  20. Sensors (Basel). 2015;15(5):10511-25 [PMID: 25951337]
  21. Acc Chem Res. 2010 May 18;43(5):631-41 [PMID: 20222738]
  22. Angew Chem Int Ed Engl. 2005 Dec 16;45(1):90-4 [PMID: 16292781]
  23. Proc Natl Acad Sci U S A. 2000 Aug 29;97(18):10113-9 [PMID: 10954739]
  24. Anal Biochem. 2014 Oct 15;463:61-6 [PMID: 25013989]
  25. Endocrinology. 1985 Feb;116(2):741-8 [PMID: 3917909]
  26. Biosens Bioelectron. 2012 Jun-Jul;36(1):35-40 [PMID: 22542926]
  27. Small. 2010 Nov 22;6(22):2520-5 [PMID: 20963795]
  28. Sensors (Basel). 2012;12(6):7423-37 [PMID: 22969352]
  29. J Am Chem Soc. 2001 May 30;123(21):4928-31 [PMID: 11457319]
  30. J Am Chem Soc. 2007 Feb 7;129(5):1042-3 [PMID: 17263380]
  31. ACS Nano. 2010 Jan 26;4(1):488-94 [PMID: 20041634]
  32. Nature. 1990 Aug 30;346(6287):818-22 [PMID: 1697402]

MeSH Term

Aptamers, Nucleotide
Biosensing Techniques
Dimethylpolysiloxanes
Equipment Design
Humans
Kallikreins
Limit of Detection
Male
Microfluidic Analytical Techniques
Molecular Probes
Prostate-Specific Antigen

Chemicals

Aptamers, Nucleotide
Dimethylpolysiloxanes
Molecular Probes
baysilon
KLK3 protein, human
Kallikreins
Prostate-Specific Antigen

Word Cloud

Created with Highcharts 10.0.0PSAaptamerdetectionselectivedevicespecificPDMSmicrofluidicbiosensingfilmwavelayerchannelsprobe3'-end10ng/mLlabel-freebeacon-basedLove-wavedevelopedprostateantigenconsistsfollowingparts:LiTaO3substrateSiO2guidetwosetinter-digitaltransducersIDTgoldimmobilizationbiorecongnitonpolydimethylsiloxaneDNA"artificialantibody"usedbiorecognitioncapturenucleotidesaddedformduplexturningaptamer-beaconTakingadvantagetarget-inducedassemblychangesarising"aptamerbeacon"highlyachievedFurthermoredesignedfabricatedrealizeautomatedquantitativesampleinjectionoptimizationexperimentalconditionsestablishedshowedgoodperformance1μg/mLlimitproposedsensormightpromisingalternativepointcarediagnosticsMicrofluidicLove-WaveBiosensingDeviceDetectionBasedAptamerBeaconProbeLovestem-loop

Similar Articles

Cited By (18)