Antibiotic Resistance Mechanisms in Bacteria: Relationships Between Resistance Determinants of Antibiotic Producers, Environmental Bacteria, and Clinical Pathogens.

Elizabeth Peterson, Parjit Kaur
Author Information
  1. Elizabeth Peterson: Department of Biology, Georgia State University, Atlanta, GA, United States.
  2. Parjit Kaur: Department of Biology, Georgia State University, Atlanta, GA, United States.

Abstract

Emergence of antibiotic resistant pathogenic bacteria poses a serious public health challenge worldwide. However, antibiotic resistance genes are not confined to the clinic; instead they are widely prevalent in different bacterial populations in the environment. Therefore, to understand development of antibiotic resistance in pathogens, we need to consider important reservoirs of resistance genes, which may include determinants that confer self-resistance in antibiotic producing soil bacteria and genes encoding intrinsic resistance mechanisms present in all or most non-producer environmental bacteria. While the presence of resistance determinants in soil and environmental bacteria does not pose a threat to human health, their mobilization to new hosts and their expression under different contexts, for example their transfer to plasmids and integrons in pathogenic bacteria, can translate into a problem of huge proportions, as discussed in this review. Selective pressure brought about by human activities further results in enrichment of such determinants in bacterial populations. Thus, there is an urgent need to understand distribution of resistance determinants in bacterial populations, elucidate resistance mechanisms, and determine environmental factors that promote their dissemination. This comprehensive review describes the major known self-resistance mechanisms found in producer soil bacteria of the genus and explores the relationships between resistance determinants found in producer soil bacteria, non-producer environmental bacteria, and clinical isolates. Specific examples highlighting potential pathways by which pathogenic clinical isolates might acquire these resistance determinants from soil and environmental bacteria are also discussed. Overall, this article provides a conceptual framework for understanding the complexity of the problem of emergence of antibiotic resistance in the clinic. Availability of such knowledge will allow researchers to build models for dissemination of resistance genes and for developing interventions to prevent recruitment of additional or novel genes into pathogens.

Keywords

References

  1. J Bacteriol. 1999 Apr;181(8):2507-12 [PMID: 10198016]
  2. Antimicrob Agents Chemother. 2000 Apr;44(4):905-9 [PMID: 10722489]
  3. J Bacteriol. 2000 Jun;182(11):3142-50 [PMID: 10809693]
  4. J Antibiot (Tokyo). 1975 Sep;28(9):681-8 [PMID: 1102514]
  5. Chem Biol. 2000 Aug;7(8):623-42 [PMID: 11048953]
  6. J Bacteriol. 2001 Jan;183(1):235-49 [PMID: 11114922]
  7. Clin Infect Dis. 2001 Jun 1;32(11):1608-14 [PMID: 11340533]
  8. Biochemistry. 2001 Jul 31;40(30):8877-86 [PMID: 11467949]
  9. Biochemistry. 2002 Feb 19;41(7):2209-16 [PMID: 11841212]
  10. Antimicrob Agents Chemother. 2002 Sep;46(9):3045-9 [PMID: 12183268]
  11. J Mol Evol. 2002 Sep;55(3):314-21 [PMID: 12187384]
  12. Lancet Infect Dis. 2002 Sep;2(9):530-8 [PMID: 12206969]
  13. Trends Biochem Sci. 2002 Sep;27(9):438 [PMID: 12217513]
  14. Antimicrob Agents Chemother. 2003 Mar;47(3):869-77 [PMID: 12604514]
  15. J Bacteriol. 1992 Oct;174(20):6386-93 [PMID: 1400191]
  16. J Bacteriol. 1992 Dec;174(23):7868-72 [PMID: 1447159]
  17. Science. 2003 Nov 28;302(5650):1569-71 [PMID: 14645850]
  18. Microbiol Mol Biol Rev. 2003 Dec;67(4):593-656 [PMID: 14665678]
  19. Antimicrob Agents Chemother. 2004 Jan;48(1):143-50 [PMID: 14693532]
  20. J Mol Biol. 2004 Apr 9;337(5):1073-7 [PMID: 15046978]
  21. Mol Microbiol. 2004 May;52(4):1107-21 [PMID: 15130128]
  22. Nat Genet. 2004 Jul;36(7):760-6 [PMID: 15208628]
  23. Curr Drug Targets Infect Disord. 2004 Sep;4(3):217-40 [PMID: 15379733]
  24. FEMS Microbiol Rev. 2004 Nov;28(5):519-42 [PMID: 15539072]
  25. J Mol Evol. 1992 Feb;34(2):115-25 [PMID: 1556747]
  26. J Biol Chem. 2005 Apr 1;280(13):13055-61 [PMID: 15632111]
  27. Chem Rev. 2005 Feb;105(2):621-32 [PMID: 15700959]
  28. Biochemistry. 2005 Feb 22;44(7):2661-70 [PMID: 15709779]
  29. FEMS Microbiol Lett. 2005 Apr 15;245(2):195-203 [PMID: 15837373]
  30. J Antimicrob Chemother. 2005 Jul;56(1):20-51 [PMID: 15914491]
  31. Antimicrob Agents Chemother. 2005 Aug;49(8):3523-5 [PMID: 16048974]
  32. Expert Opin Investig Drugs. 2005 Aug;14(8):973-95 [PMID: 16050791]
  33. Nat Rev Microbiol. 2005 Sep;3(9):711-21 [PMID: 16138099]
  34. FEMS Microbiol Lett. 2005 Nov 1;252(1):89-96 [PMID: 16213676]
  35. Clin Microbiol Rev. 2005 Oct;18(4):657-86 [PMID: 16223952]
  36. J Biosci Bioeng. 2002;93(2):105-16 [PMID: 16233174]
  37. Antimicrob Agents Chemother. 2006 Jan;50(1):171-7 [PMID: 16377683]
  38. Science. 2006 Jan 20;311(5759):374-7 [PMID: 16424339]
  39. J Bacteriol. 2006 Apr;188(7):2726-9 [PMID: 16547063]
  40. J Bacteriol. 1991 Nov;173(22):7213-8 [PMID: 1657884]
  41. Biotechnol Lett. 2006 Mar;28(6):409-17 [PMID: 16614907]
  42. Int Microbiol. 2006 Mar;9(1):9-19 [PMID: 16636985]
  43. Annu Rev Microbiol. 2006;60:451-75 [PMID: 16771651]
  44. Science. 2006 Jul 7;313(5783):89-92 [PMID: 16825569]
  45. Drug Resist Updat. 1998;1(4):223-6 [PMID: 16904404]
  46. Curr Opin Microbiol. 2006 Oct;9(5):466-75 [PMID: 16942899]
  47. Mol Biosyst. 2007 Jan;3(1):60-74 [PMID: 17216057]
  48. Nat Rev Microbiol. 2007 Mar;5(3):175-86 [PMID: 17277795]
  49. Mol Microbiol. 2007 Apr;64(1):83-93 [PMID: 17376074]
  50. FEMS Microbiol Lett. 2007 Jun;271(2):147-61 [PMID: 17490428]
  51. J Bacteriol. 2007 Aug;189(15):5608-16 [PMID: 17545290]
  52. J Biomed Sci. 2008 Jan;15(1):5-14 [PMID: 17657587]
  53. Mol Microbiol. 1991 Dec;5(12):2923-33 [PMID: 1809836]
  54. PLoS One. 2008 Feb 20;3(2):e1619 [PMID: 18286176]
  55. Emerg Infect Dis. 2008 Mar;14(3):423-8 [PMID: 18325257]
  56. FEMS Microbiol Lett. 2008 May;282(2):147-59 [PMID: 18399991]
  57. Gene. 1991 Jun 15;102(1):27-32 [PMID: 1864505]
  58. Nucleic Acids Res. 2009 Jan;37(Database issue):D443-7 [PMID: 18832362]
  59. ISME J. 2009 Feb;3(2):243-51 [PMID: 18843302]
  60. Biochim Biophys Acta. 2009 May;1794(5):769-81 [PMID: 19026770]
  61. Mol Biosyst. 2009 Jan;5(1):77-90 [PMID: 19081934]
  62. Science. 2009 Jan 2;323(5910):139-41 [PMID: 19119236]
  63. Clin Microbiol Rev. 2009 Jan;22(1):161-82, Table of Contents [PMID: 19136439]
  64. Annu Rev Biochem. 2009;78:119-46 [PMID: 19231985]
  65. Proc Natl Acad Sci U S A. 1991 Oct 1;88(19):8553-7 [PMID: 1924314]
  66. Methods Mol Biol. 2009;532:397-411 [PMID: 19271198]
  67. Biochemistry. 1991 Oct 29;30(43):10408-15 [PMID: 1931965]
  68. FEMS Microbiol Rev. 2009 Jul;33(4):757-84 [PMID: 19416365]
  69. Environ Sci Technol. 2010 Jan 15;44(2):580-7 [PMID: 20025282]
  70. Environ Microbiol. 2010 Mar;12(3):783-96 [PMID: 20067498]
  71. ISME J. 2010 May;4(5):648-59 [PMID: 20090786]
  72. Antimicrob Agents Chemother. 2010 May;54(5):1684-92 [PMID: 20176899]
  73. Nat Rev Microbiol. 2010 Aug;8(8):541-51 [PMID: 20634809]
  74. Microbiol Mol Biol Rev. 2010 Sep;74(3):417-33 [PMID: 20805405]
  75. Drug Resist Updat. 2010 Dec;13(6):151-71 [PMID: 20833577]
  76. J Biol Chem. 2010 Dec 3;285(49):38324-36 [PMID: 20876527]
  77. RNA. 2011 Feb;17(2):251-62 [PMID: 21159796]
  78. Lett Appl Microbiol. 2011 Jun;52(6):559-64 [PMID: 21395627]
  79. FEMS Microbiol Rev. 2011 Sep;35(5):756-67 [PMID: 21521245]
  80. PLoS One. 2011 May 09;6(5):e19589 [PMID: 21573013]
  81. FEMS Microbiol Rev. 2011 Sep;35(5):856-71 [PMID: 21658082]
  82. Front Microbiol. 2010 Dec 08;1:134 [PMID: 21687759]
  83. Antimicrob Agents Chemother. 2011 Sep;55(9):4283-9 [PMID: 21690280]
  84. PLoS Pathog. 2011 Jul;7(7):e1002158 [PMID: 21811410]
  85. Nature. 2011 Aug 31;477(7365):457-61 [PMID: 21881561]
  86. Front Microbiol. 2011 Sep 28;2:203 [PMID: 22046172]
  87. Antimicrob Agents Chemother. 1990 Aug;34(8):1611-4 [PMID: 2221873]
  88. Int J Med Microbiol. 2012 Mar;302(2):63-8 [PMID: 22226846]
  89. Antimicrob Agents Chemother. 2012 Apr;56(4):1784-96 [PMID: 22232274]
  90. PLoS One. 2012;7(4):e34953 [PMID: 22509370]
  91. FEMS Microbiol Lett. 2012 Jul;332(2):146-52 [PMID: 22553940]
  92. FEBS J. 2012 Sep;279(17):3203-13 [PMID: 22788848]
  93. Curr Opin Microbiol. 2012 Oct;15(5):561-9 [PMID: 22890188]
  94. BMC Biotechnol. 2012 Aug 20;12:52 [PMID: 22906146]
  95. Science. 2012 Aug 31;337(6098):1107-11 [PMID: 22936781]
  96. Curr Opin Microbiol. 2012 Oct;15(5):577-82 [PMID: 22954750]
  97. MBio. 2012 Oct 16;3(5):e00191-12 [PMID: 23073761]
  98. ACS Chem Biol. 2013 Jan 18;8(1):105-15 [PMID: 23110460]
  99. Antimicrob Agents Chemother. 2013 Apr;57(4):1968-70 [PMID: 23357771]
  100. Int J Med Microbiol. 2013 Aug;303(6-7):298-304 [PMID: 23499304]
  101. Int J Med Microbiol. 2013 Aug;303(6-7):287-92 [PMID: 23499305]
  102. Mob Genet Elements. 2012 Sep 1;2(5):211-223 [PMID: 23550063]
  103. Antimicrob Agents Chemother. 2013 Jul;57(7):3348-57 [PMID: 23650175]
  104. Nature. 2013 Jul 11;499(7457):219-22 [PMID: 23748443]
  105. Environ Microbiol Rep. 2013 Feb;5(1):66-73 [PMID: 23757132]
  106. J Bacteriol. 1990 Aug;172(8):4710-4 [PMID: 2376570]
  107. Environ Health Perspect. 2013 Sep;121(9):993-1001 [PMID: 23838256]
  108. World J Microbiol Biotechnol. 2014 Jan;30(1):253-61 [PMID: 23900905]
  109. J Gen Microbiol. 1990 Mar;136(3):589-98 [PMID: 2391494]
  110. Antimicrob Agents Chemother. 2013 Nov;57(11):5233-8 [PMID: 23939891]
  111. Int J Med Microbiol. 2014 Jan;304(1):44-50 [PMID: 24119565]
  112. FEBS Lett. 1988 Mar 28;230(1-2):171-5 [PMID: 2450783]
  113. Nat Rev Microbiol. 2014 Mar;12(3):181-96 [PMID: 24509783]
  114. Chem Biol. 2014 Mar 20;21(3):389-397 [PMID: 24560608]
  115. Nat Genet. 2014 Apr;46(4):336-44 [PMID: 24562188]
  116. J Biol Chem. 2014 May 2;289(18):12633-46 [PMID: 24634217]
  117. Curr Biol. 2014 May 19;24(10):1096-100 [PMID: 24814145]
  118. Appl Environ Microbiol. 2014 Jul;80(14):4350-62 [PMID: 24814786]
  119. Microbiol Mol Biol Rev. 2014 Jun;78(2):257-77 [PMID: 24847022]
  120. Biochem Biophys Res Commun. 2014 Oct 17;453(2):254-67 [PMID: 24878531]
  121. Antimicrob Agents Chemother. 2014 Sep;58(9):5191-201 [PMID: 24957828]
  122. Mol Microbiol. 2014 Aug;93(3):391-402 [PMID: 24964724]
  123. Infect Drug Resist. 2014 Jun 20;7:167-76 [PMID: 25018641]
  124. IUBMB Life. 2014 Aug;66(8):572-7 [PMID: 25044998]
  125. PLoS Pathog. 2014 Jul 31;10(7):e1004219 [PMID: 25078987]
  126. Environ Int. 2014 Dec;73:167-75 [PMID: 25127043]
  127. Expert Rev Anti Infect Ther. 2014 Oct;12(10):1221-36 [PMID: 25199988]
  128. Genome Biol Evol. 2014 Sep 25;6(10):2697-708 [PMID: 25260585]
  129. Environ Microbiol. 2015 Apr;17(4):913-30 [PMID: 25286745]
  130. MBio. 2014 Oct 07;5(5):e01918-14 [PMID: 25293762]
  131. Biochemistry. 2014 Nov 11;53(44):6901-9 [PMID: 25299801]
  132. ISME J. 2015 Mar 17;9(4):934-45 [PMID: 25333461]
  133. MBio. 2014 Oct 21;5(5):e01972-14 [PMID: 25336457]
  134. J Antibiot (Tokyo). 2015 Apr;68(4):223-45 [PMID: 25351947]
  135. Philos Trans R Soc Lond B Biol Sci. 2014 Nov 19;369(1656):null [PMID: 25405961]
  136. Nat Rev Microbiol. 2015 Jan;13(1):42-51 [PMID: 25435309]
  137. Nat Rev Microbiol. 2015 Feb;13(2):116-23 [PMID: 25534811]
  138. Gene. 1989 Sep 1;81(1):65-72 [PMID: 2553539]
  139. Adv Cancer Res. 2015;125:71-96 [PMID: 25640267]
  140. Microbiol Mol Biol Rev. 2015 Mar;79(1):101-16 [PMID: 25652543]
  141. Biochem Biophys Res Commun. 2015 Mar 27;459(1):148-53 [PMID: 25721665]
  142. Acta Crystallogr D Biol Crystallogr. 2015 Mar;71(Pt 3):732-41 [PMID: 25760620]
  143. PLoS One. 2015 Mar 25;10(3):e0069533 [PMID: 25807523]
  144. Environ Microbiol. 2016 Jan;18(1):118-32 [PMID: 25923468]
  145. J Antimicrob Chemother. 2015 Aug;70(8):2191-8 [PMID: 25957384]
  146. Water Res. 2015 Sep 15;81:1-14 [PMID: 26024959]
  147. J Biol Chem. 2015 Jul 31;290(31):18914-23 [PMID: 26082492]
  148. Proc Natl Acad Sci U S A. 2015 Oct 20;112(42):12956-61 [PMID: 26438831]
  149. Biochemistry. 2015 Nov 17;54(45):6842-51 [PMID: 26512730]
  150. J Gen Virol. 2016 Jan;97(1):258-68 [PMID: 26537974]
  151. J Microbiol Biotechnol. 2016 Feb;26(2):263-9 [PMID: 26562692]
  152. BMC Genomics. 2015 Nov 17;16:964 [PMID: 26576951]
  153. Microbiol Mol Biol Rev. 2015 Nov 25;80(1):1-43 [PMID: 26609051]
  154. J Antibiot (Tokyo). 2016 Sep;69(9):660-85 [PMID: 26758489]
  155. Protein Sci. 2016 Apr;25(4):787-803 [PMID: 26813250]
  156. Front Microbiol. 2016 Feb 19;7:173 [PMID: 26925045]
  157. Annu Rev Virol. 2015 Nov;2(1):181-201 [PMID: 26958912]
  158. Gene. 1989 Dec 28;85(2):283-91 [PMID: 2697637]
  159. Antibiotics (Basel). 2014 Nov 04;3(4):572-94 [PMID: 27025757]
  160. Molecules. 2016 May 10;21(5): [PMID: 27171072]
  161. Infect Dis Clin North Am. 2016 Jun;30(2):523-537 [PMID: 27208771]
  162. Microbiol Spectr. 2016 Apr;4(2): [PMID: 27227291]
  163. Drug Resist Updat. 2016 Jul;27:1-13 [PMID: 27449594]
  164. Cold Spring Harb Perspect Med. 2016 Oct 3;6(10):null [PMID: 27527699]
  165. ACS Infect Dis. 2015 Jun 12;1(6):243-52 [PMID: 27622740]
  166. Microbiol Spectr. 2016 Aug;4(4): [PMID: 27726801]
  167. ACS Infect Dis. 2017 Feb 10;3(2):132-143 [PMID: 27785912]
  168. Nat Commun. 2016 Nov 07;7:13333 [PMID: 27819286]
  169. Microb Pathog. 2016 Dec;101:56-67 [PMID: 27836760]
  170. Mol Microbiol. 2017 Feb;103(4):713-728 [PMID: 27874224]
  171. Biochem Pharmacol. 2017 Jun 1;133:20-28 [PMID: 27940264]
  172. Biochemistry. 2017 Apr 4;56(13):1921-1931 [PMID: 28272881]
  173. J Bacteriol. 1988 Apr;170(4):1739-45 [PMID: 2832378]
  174. J Antimicrob Chemother. 2017 Jun 1;72(6):1624-1631 [PMID: 28369562]
  175. EMBO J. 1988 Jul;7(7):2255-9 [PMID: 2843361]
  176. Arch Microbiol. 1988;150(2):184-92 [PMID: 2844130]
  177. Front Med. 2017 Jun;11(2):161-168 [PMID: 28500429]
  178. MBio. 2017 Jun 6;8(3): [PMID: 28588130]
  179. Nat Commun. 2017 Jun 07;8:15784 [PMID: 28589945]
  180. Trends Microbiol. 2017 Nov;25(11):893-905 [PMID: 28641931]
  181. Microbiol Res. 2017 Sep;202:30-35 [PMID: 28647120]
  182. Annu Rev Microbiol. 2017 Sep 8;71:309-329 [PMID: 28657887]
  183. Microbiol Spectr. 2017 Jul;5(4): [PMID: 28752817]
  184. Microb Pathog. 2017 Oct;111:481-486 [PMID: 28923605]
  185. Microb Ecol Health Dis. 2017 Jan 01;28(1):1345574 [PMID: 28959177]
  186. FEMS Microbiol Rev. 2018 Jan 1;42(1): [PMID: 29069382]
  187. Microbiol Spectr. 2018 Jan;6(1): [PMID: 29350130]
  188. Nucleic Acids Res. 2018 Apr 20;46(7):3753-3763 [PMID: 29415157]
  189. Environ Int. 2018 Jun;115:133-141 [PMID: 29567433]
  190. PLoS Pathog. 2018 Apr 19;14(4):e1006924 [PMID: 29672612]
  191. Lett Appl Microbiol. 2018 Jul;67(1):9-14 [PMID: 29675838]
  192. FEBS Lett. 1985 Feb 25;181(2):385-9 [PMID: 2982666]
  193. J Bacteriol. 1985 Mar;161(3):1010-6 [PMID: 2982781]
  194. Emerg Microbes Infect. 2018 Oct 10;7(1):168 [PMID: 30302018]
  195. J Gen Microbiol. 1988 Mar;134(3):585-98 [PMID: 3053973]
  196. Nature. 1988 Mar 10;332(6160):173-6 [PMID: 3126399]
  197. Gene. 1985;38(1-3):103-10 [PMID: 3934045]
  198. J Biol Chem. 1970 Dec 25;245(24):6683-9 [PMID: 4099008]
  199. Proc Natl Acad Sci U S A. 1973 Aug;70(8):2276-80 [PMID: 4209515]
  200. J Gen Microbiol. 1984 Nov;130(11):2883-91 [PMID: 6084703]
  201. Annu Rev Microbiol. 1984;38:339-57 [PMID: 6388496]
  202. Antimicrob Agents Chemother. 1980 Jan;17(1):1-7 [PMID: 6965440]
  203. J Antibiot (Tokyo). 1981 Aug;34(8):1070-2 [PMID: 7319922]
  204. Gene. 1994 Dec 30;151(1-2):11-6 [PMID: 7530224]
  205. FEBS Lett. 1995 Mar 27;362(1):80-4 [PMID: 7535252]
  206. Antimicrob Agents Chemother. 1995 Mar;39(3):577-85 [PMID: 7793855]
  207. Biochem J. 1994 Dec 15;304 ( Pt 3):1021-2 [PMID: 7818465]
  208. Antimicrob Agents Chemother. 1994 Jun;38(6):1408-12 [PMID: 8092846]
  209. Antimicrob Agents Chemother. 1993 Aug;37(8):1563-71 [PMID: 8215264]
  210. Microbiol Rev. 1993 Mar;57(1):138-63 [PMID: 8385262]
  211. EMBO J. 1993 Feb;12(2):631-9 [PMID: 8440253]
  212. J Bacteriol. 1996 Mar;178(6):1707-11 [PMID: 8626300]
  213. J Bacteriol. 1996 Jun;178(11):3246-51 [PMID: 8655505]
  214. J Bacteriol. 1996 Nov;178(21):6266-74 [PMID: 8892828]
  215. J Bacteriol. 1997 Mar;179(5):1796-804 [PMID: 9045843]
  216. J Bacteriol. 1997 Apr;179(8):2512-8 [PMID: 9098046]
  217. Proc Natl Acad Sci U S A. 1997 Jun 10;94(12):6480-3 [PMID: 9177243]
  218. Trends Microbiol. 1997 Jun;5(6):234-40 [PMID: 9211644]
  219. FEMS Microbiol Lett. 1997 Dec 15;157(2):295-9 [PMID: 9435111]
  220. Biol Chem. 1998 Jul;379(7):847-55 [PMID: 9705148]
  221. Antimicrob Agents Chemother. 1998 Sep;42(9):2215-20 [PMID: 9736537]
  222. Chem Biol. 1998 Sep;5(9):489-504 [PMID: 9751644]
  223. J Bacteriol. 1998 Nov;180(21):5792-5 [PMID: 9791137]
  224. FEBS Lett. 1999 Jan 8;442(1):34-8 [PMID: 9923599]
  225. Front Biosci. 1999 Feb 01;4:D132-40 [PMID: 9924143]

Word Cloud

Created with Highcharts 10.0.0resistancebacteriaantibioticdeterminantsenvironmentalgenessoilmechanismspathogenicbacterialpopulationspathogensself-resistancedisseminationproducerclinicalhealthclinicdifferentunderstandneednon-producerhumantransferproblemdiscussedreviewfoundisolatesAntibioticResistancegeneEmergenceresistantposesseriouspublicchallengeworldwideHoweverconfinedinsteadwidelyprevalentenvironmentThereforedevelopmentconsiderimportantreservoirsmayincludeconferproducingencodingintrinsicpresentpresenceposethreatmobilizationnewhostsexpressioncontextsexampleplasmidsintegronscantranslatehugeproportionsSelectivepressurebroughtactivitiesresultsenrichmentThusurgentdistributionelucidatedeterminefactorspromotecomprehensivedescribesmajorknowngenusexploresrelationshipsSpecificexampleshighlightingpotentialpathwaysmightacquirealsoOverallarticleprovidesconceptualframeworkunderstandingcomplexityemergenceAvailabilityknowledgewillallowresearchersbuildmodelsdevelopinginterventionspreventrecruitmentadditionalnovelMechanismsBacteria:RelationshipsDeterminantsProducersEnvironmentalBacteriaClinicalPathogensStreptomyceshorizontal

Similar Articles

Cited By