OpenLB
Open Library of Bioscience
Advanced Search
Frontiers in immunology
2019;10 1166.

Pregnancy Galectinology: Insights Into a Complex Network of Glycan Binding Proteins.

Sandra M Blois, Gabriela Dveksler, Gerardo R Vasta, Nancy Freitag, Véronique Blanchard, Gabriela Barrientos
Author Information
  1. Sandra M Blois: Reproductive Medicine Research Group, Division of General Internal and Psychosomatic Medicine, Berlin Institute of Health, Charité - Universitätsmedizin Berlin, Corporate Member of Freie Universität Berlin, Humboldt-Universität zu Berlin, Berlin, Germany.
  2. Gabriela Dveksler: Department of Pathology, Uniformed Services University of the Health Sciences, Bethesda, MD, United States.
  3. Gerardo R Vasta: Department of Microbiology and Immunology, Institute of Marine and Environmental Technology, University of Maryland School of Medicine, UMB, Baltimore, MD, United States.
  4. Nancy Freitag: Experimental and Clinical Research Center, a Cooperation Between the Max Delbrück Center for Molecular Medicine in the Helmholtz Association, and Charité - Universitätsmedizin Berlin, Berlin, Germany.
  5. Véronique Blanchard: Berlin Institute of Health, Institute of Laboratory Medicine, Clinical Chemistry and Pathobiochemistry, Charité - Universitätsmedizin Berlin, Corporate Member of Freie Universität Berlin, Humboldt-Universität zu Berlin, Berlin, Germany.
  6. Gabriela Barrientos: Laboratory of Experimental Medicine, Hospital Alemán, School of Medicine, University of Buenos Aires, CONICET, Buenos Aires, Argentina.
PMID: 31231368 DOI: 10.3389/fimmu.2019.01166

Abstract

Galectins are a phylogenetically conserved family of soluble β-galactoside binding proteins, consisting of 15 different types, each with a specific function. Galectins contribute to placentation by regulating trophoblast development, migration, and invasion during early pregnancy. In addition, galectins are critical players regulating maternal immune tolerance to the embedded embryo. Recently, the role of galectins in angiogenesis during decidualization and in placenta formation has gained attention. Altered expression of galectins is associated with abnormal pregnancies and infertility. This review focuses on the role of galectins in pregnancy-associated processes and discusses the relevance of galectin-glycan interactions as potential therapeutic targets in pregnancy disorders.

Keywords

galectins glycans placentation preeclampsia pregnancy

References

  1. Exp Cell Res. 1999 Nov 1;252(2):250-61 [PMID: 10527616]
  2. Placenta. 1999 Nov;20(8):703-10 [PMID: 10527825]
  3. Am J Pathol. 2000 Mar;156(3):899-909 [PMID: 10702407]
  4. Cardiovasc Res. 2000 Jan 14;45(2):493-502 [PMID: 10728371]
  5. Dev Biol. 2001 Jan 1;229(1):203-14 [PMID: 11133164]
  6. J Biol Chem. 2001 Jan 26;276(4):2652-7 [PMID: 11160123]
  7. J Clin Endocrinol Metab. 2001 Jun;86(6):2484-93 [PMID: 11397844]
  8. J Biol Chem. 2002 Apr 12;277(15):13091-8 [PMID: 11809773]
  9. EMBO J. 2002 Mar 1;21(5):885-97 [PMID: 11867517]
  10. Mol Cell Endocrinol. 2002 Feb 22;187(1-2):207-12 [PMID: 11988329]
  11. Development. 2002 Jul;129(13):3137-46 [PMID: 12070089]
  12. Glycobiology. 2002 Aug;12(8):451-61 [PMID: 12145186]
  13. Biochim Biophys Acta. 2002 Sep 19;1572(2-3):209-31 [PMID: 12223271]
  14. Biochim Biophys Acta. 2002 Sep 19;1572(2-3):232-54 [PMID: 12223272]
  15. J Leukoc Biol. 2003 May;73(5):650-6 [PMID: 12714580]
  16. Glycobiology. 2003 Oct;13(10):713-23 [PMID: 12851289]
  17. Biol Reprod. 2003 Nov;69(5):1458-71 [PMID: 12890718]
  18. J Clin Invest. 2003 Aug;112(3):389-97 [PMID: 12897206]
  19. Nat Immunol. 2003 Nov;4(11):1093-101 [PMID: 14556005]
  20. J Exp Med. 2003 Oct 20;198(8):1201-12 [PMID: 14568979]
  21. Glycoconj J. 2004;19(7-9):517-26 [PMID: 14758075]
  22. Glycoconj J. 2004;19(7-9):593-600 [PMID: 14758084]
  23. Nat Immunol. 2004 Mar;5(3):266-71 [PMID: 14758358]
  24. Mol Biol Evol. 2004 Jul;21(7):1177-87 [PMID: 14963092]
  25. Eur J Biochem. 2004 Mar;271(6):1065-78 [PMID: 15009185]
  26. Placenta. 2004 Aug;25(7):608-22 [PMID: 15193867]
  27. Placenta. 2004 Nov;25(10):797-802 [PMID: 15451194]
  28. J Mol Biol. 2004 Oct 29;343(4):957-70 [PMID: 15476813]
  29. Mol Hum Reprod. 2005 Mar;11(3):189-94 [PMID: 15681515]
  30. Fungal Genet Biol. 2005 Apr;42(4):293-305 [PMID: 15749049]
  31. Glycoconj J. 2004;21(8-9):503-21 [PMID: 15750792]
  32. Biochem Biophys Res Commun. 2005 May 13;330(3):999-1004 [PMID: 15809094]
  33. J Biol Chem. 2005 Nov 4;280(44):37266-77 [PMID: 16105842]
  34. J Clin Endocrinol Metab. 2005 Nov;90(11):6170-6 [PMID: 16105962]
  35. J Biol Chem. 2005 Nov 18;280(46):38583-91 [PMID: 16166092]
  36. FEBS J. 2005 Dec;272(24):6179-217 [PMID: 16336259]
  37. J Immunol. 2006 Jan 15;176(2):778-89 [PMID: 16393961]
  38. Arch Immunol Ther Exp (Warsz). 2005 Nov-Dec;53(6):497-504 [PMID: 16407782]
  39. J Virol. 2006 Feb;80(3):1513-23 [PMID: 16415027]
  40. Glycobiology. 2006 May;16(5):402-14 [PMID: 16449348]
  41. Blood. 2007 Mar 1;109(5):2058-65 [PMID: 17110462]
  42. Prenat Diagn. 2007 Mar;27(3):258-63 [PMID: 17278173]
  43. Dev Dyn. 2007 Apr;236(4):1014-24 [PMID: 17366633]
  44. Cell Mol Life Sci. 2007 Jul;64(13):1679-700 [PMID: 17497244]
  45. Blood. 2007 Sep 1;110(5):1550-8 [PMID: 17502455]
  46. Clin Sci (Lond). 2007 Jul;113(1):1-13 [PMID: 17536998]
  47. Cells Tissues Organs. 2007;185(4):269-84 [PMID: 17587801]
  48. Nat Immunol. 2007 Aug;8(8):825-34 [PMID: 17589510]
  49. Placenta. 2007 Nov-Dec;28(11-12):1165-73 [PMID: 17664004]
  50. Folia Biol (Praha). 2007;53(4):109-28 [PMID: 17706016]
  51. Curr Opin Struct Biol. 2007 Oct;17(5):513-20 [PMID: 17950594]
  52. Cancer Res. 2007 Nov 1;67(21):10222-9 [PMID: 17974963]
  53. Nat Med. 2007 Dec;13(12):1450-7 [PMID: 18026113]
  54. Am J Pathol. 2008 Feb;172(2):545-53 [PMID: 18202194]
  55. Oncogene. 2008 Jun 12;27(26):3746-53 [PMID: 18223683]
  56. Gene. 2008 Mar 31;411(1-2):46-58 [PMID: 18280060]
  57. Mol Biol Rep. 2009 May;36(5):823-30 [PMID: 18401566]
  58. Biol Reprod. 2008 Aug;79(2):233-9 [PMID: 18417712]
  59. Endocr J. 2008 Oct;55(5):879-87 [PMID: 18506087]
  60. J Matern Fetal Neonatal Med. 2008 Jul;21(7):429-42 [PMID: 18570123]
  61. Biochemistry. 2008 Aug 19;47(33):8470-6 [PMID: 18652478]
  62. Biochim Biophys Acta. 2008 Oct;1780(10):1131-42 [PMID: 18675319]
  63. Fetal Diagn Ther. 2008;24(3):230-6 [PMID: 18753763]
  64. Glycoconj J. 2009 Apr;26(3):277-83 [PMID: 18763034]
  65. Virchows Arch. 2008 Oct;453(4):387-400 [PMID: 18791734]
  66. Proc Natl Acad Sci U S A. 2008 Oct 14;105(41):15819-24 [PMID: 18824694]
  67. Endocrinology. 2009 Feb;150(2):990-9 [PMID: 18845630]
  68. Proc Natl Acad Sci U S A. 2008 Nov 25;105(47):18472-7 [PMID: 19011096]
  69. J Biol Chem. 2009 Feb 20;284(8):4989-99 [PMID: 19103599]
  70. J Immunol. 2009 May 1;182(9):5419-29 [PMID: 19380789]
  71. Nat Rev Microbiol. 2009 Jun;7(6):424-38 [PMID: 19444247]
  72. Proc Natl Acad Sci U S A. 2009 Jun 16;106(24):9731-6 [PMID: 19497882]
  73. Immunol Rev. 2009 Jul;230(1):114-27 [PMID: 19594632]
  74. Immunol Rev. 2009 Jul;230(1):172-87 [PMID: 19594636]
  75. Eur J Cell Biol. 2009 Dec;88(12):753-63 [PMID: 19717209]
  76. Invest Ophthalmol Vis Sci. 2010 Jun;51(6):3244-52 [PMID: 20071673]
  77. Reproduction. 2010 Apr;139(4):789-98 [PMID: 20133364]
  78. Matrix Biol. 2010 Jun;29(5):369-82 [PMID: 20385232]
  79. Reprod Biomed Online. 2007;14 Spec No 1:101-9 [PMID: 20483405]
  80. J Cell Biol. 1991 Jul;114(1):143-53 [PMID: 2050739]
  81. Placenta. 2010 Sep;31(9):825-32 [PMID: 20656349]
  82. Biochemistry. 2010 Sep 7;49(35):7652-8 [PMID: 20666428]
  83. Mol Biosyst. 2010 Dec;6(12):2373-9 [PMID: 20957246]
  84. Cell Death Differ. 2011 May;18(5):806-16 [PMID: 21113146]
  85. Mol Immunol. 2011 Jan;48(4):670-7 [PMID: 21146220]
  86. J Clin Immunol. 2011 Feb;31(1):10-21 [PMID: 21184154]
  87. J Biol Chem. 2011 Apr 1;286(13):11346-55 [PMID: 21288902]
  88. Acta Crystallogr D Biol Crystallogr. 2011 Mar;67(Pt 3):204-11 [PMID: 21358051]
  89. Proc Natl Acad Sci U S A. 2011 Jun 28;108(26):10650-5 [PMID: 21670307]
  90. Acta Histochem. 2011 Dec;113(8):815-25 [PMID: 21774970]
  91. PLoS One. 2011;6(7):e21564 [PMID: 21799738]
  92. Biochemistry. 2011 Sep 20;50(37):7842-57 [PMID: 21848324]
  93. Placenta. 2011 Nov;32(11):909-11 [PMID: 21862124]
  94. J Clin Endocrinol Metab. 2011 Dec;96(12):3759-67 [PMID: 21917866]
  95. Adv Exp Med Biol. 2012;946:21-36 [PMID: 21948360]
  96. Trends Endocrinol Metab. 2012 Jan;23(1):23-31 [PMID: 22036528]
  97. Reprod Biomed Online. 2012 Jan;24(1):116-22 [PMID: 22119323]
  98. PLoS One. 2011;6(12):e28514 [PMID: 22174828]
  99. Glycobiology. 2012 Oct;22(10):1374-86 [PMID: 22752006]
  100. Mol Hum Reprod. 2013 Jan;19(1):43-53 [PMID: 23002109]
  101. Biol Reprod. 2013 Jan 25;88(1):22 [PMID: 23242525]
  102. Mol Aspects Med. 2013 Oct;34(5):981-1023 [PMID: 23276825]
  103. J Cell Biol. 1990 May;110(5):1681-91 [PMID: 2335567]
  104. Fetal Diagn Ther. 2013;33(4):257-64 [PMID: 23406577]
  105. Proc Natl Acad Sci U S A. 2013 Jul 9;110(28):11451-6 [PMID: 23798433]
  106. J Reprod Immunol. 2014 Mar;101-102:127-134 [PMID: 23953090]
  107. Hum Reprod Update. 2014 Mar-Apr;20(2):175-93 [PMID: 24077937]
  108. Biochim Biophys Acta. 2014 Feb;1842(2):284-92 [PMID: 24333696]
  109. Reprod Sci. 2014 Jan 8;:null [PMID: 24401476]
  110. Glycobiology. 2014 May;24(5):428-41 [PMID: 24451991]
  111. Placenta. 2014 Mar;35(3):195-201 [PMID: 24522232]
  112. Placenta. 2014 Apr;35(4):281-5 [PMID: 24534543]
  113. PLoS One. 2014 Mar 11;9(3):e91794 [PMID: 24618590]
  114. PLoS One. 2014 Mar 20;9(3):e92371 [PMID: 24651720]
  115. Mol Hum Reprod. 2014 Aug;20(8):787-98 [PMID: 24782449]
  116. Nat Cell Biol. 2014 Jun;16(6):595-606 [PMID: 24837829]
  117. Histochem Cell Biol. 2014 Nov;142(5):541-53 [PMID: 24854997]
  118. Glycobiology. 2014 Oct;24(10):907-14 [PMID: 24939370]
  119. Glycobiology. 2014 Oct;24(10):966-73 [PMID: 24957054]
  120. Immunity. 2014 Aug 21;41(2):270-82 [PMID: 25065622]
  121. Am J Reprod Immunol. 2015 Mar;73(3):251-62 [PMID: 25091957]
  122. Glycobiology. 2014 Dec;24(12):1275-82 [PMID: 25108228]
  123. Front Immunol. 2014 Aug 20;5:348 [PMID: 25191322]
  124. Methods Mol Biol. 2015;1207:327-41 [PMID: 25253151]
  125. Placenta. 2014 Nov;35(11):855-65 [PMID: 25266889]
  126. Placenta. 2015 Feb;36(2):191-8 [PMID: 25499680]
  127. Placenta. 2015 Feb;36(2):101-14 [PMID: 25524060]
  128. Molecules. 2015 Jan 22;20(2):1788-823 [PMID: 25621423]
  129. Placenta. 2015 Apr;36(4):357-64 [PMID: 25659296]
  130. Placenta. 2015 Apr;36(4):438-45 [PMID: 25707742]
  131. Proc Natl Acad Sci U S A. 2015 Apr 7;112(14):4334-9 [PMID: 25805821]
  132. PLoS One. 2015 Apr 17;10(4):e0124347 [PMID: 25884209]
  133. Fish Shellfish Immunol. 2015 Sep;46(1):94-106 [PMID: 25982395]
  134. J Pathol Transl Med. 2015 May;49(3):181-208 [PMID: 26018511]
  135. J Cell Sci. 2015 Jul 1;128(13):2213-9 [PMID: 26092931]
  136. Hum Reprod. 2015 Sep;30(9):2064-75 [PMID: 26109616]
  137. Immunol Cell Biol. 2016 Feb;94(2):213-9 [PMID: 26282995]
  138. Cell Adh Migr. 2016 Mar 3;10(1-2):28-38 [PMID: 26418280]
  139. Histol Histopathol. 2016 Oct;31(10):1095-111 [PMID: 26901464]
  140. Annu Rev Immunol. 2016 May 20;34:243-64 [PMID: 26907217]
  141. Mol Cell Proteomics. 2016 Jun;15(6):1857-66 [PMID: 26929217]
  142. Int J Gynecol Pathol. 2017 Jan;36(1):42-49 [PMID: 26937865]
  143. J Reprod Immunol. 2016 Apr;114:38-43 [PMID: 26956510]
  144. J Physiol. 2016 Sep 1;594(17):4727-40 [PMID: 26970222]
  145. Exp Cell Res. 2016 Mar 15;342(2):125-34 [PMID: 26992288]
  146. Int J Mol Sci. 2016 Apr 07;17(4):523 [PMID: 27070577]
  147. Sci Rep. 2016 Apr 14;6:23296 [PMID: 27075729]
  148. Int J Mol Sci. 2016 Apr 28;17(5): [PMID: 27136536]
  149. Reprod Sci. 2017 Feb;24(2):313-323 [PMID: 27334383]
  150. Fertil Steril. 2016 Sep 1;106(3):499-510 [PMID: 27477190]
  151. J Virol. 2016 Oct 14;90(21):9758-9765 [PMID: 27535055]
  152. J Reprod Immunol. 2017 Feb;119:98-106 [PMID: 27613663]
  153. Trends Biochem Sci. 2017 Apr;42(4):255-273 [PMID: 27986367]
  154. Curr Opin Immunol. 2017 Apr;45:8-15 [PMID: 28088061]
  155. Sci Rep. 2017 Mar 16;7:44601 [PMID: 28300160]
  156. Hypertens Pregnancy. 2017 May;36(2):186-195 [PMID: 28524718]
  157. PLoS One. 2017 Jun 26;12(6):e0177472 [PMID: 28650992]
  158. Cell Death Differ. 2017 Nov;24(11):1937-1947 [PMID: 28731466]
  159. J Leukoc Biol. 2017 Nov;102(5):1237-1247 [PMID: 28811319]
  160. Sci Signal. 2017 Sep 26;10(498):null [PMID: 28951537]
  161. Biol Pharm Bull. 2017;40(10):1789-1795 [PMID: 28966253]
  162. J Biochem. 2018 Jan 1;163(1):39-50 [PMID: 28992109]
  163. Birth Defects Res. 2017 Oct 16;109(17):1377-1385 [PMID: 29105382]
  164. Mol Cell Endocrinol. 2018 Jul 15;470:228-239 [PMID: 29122660]
  165. Am J Reprod Immunol. 2018 Feb;79(2): [PMID: 29205636]
  166. Sci Rep. 2017 Dec 6;7(1):17086 [PMID: 29213102]
  167. Front Immunol. 2017 Nov 29;8:1648 [PMID: 29238345]
  168. J Diabetes Investig. 2018 Jul;9(4):967-974 [PMID: 29288571]
  169. Sci Rep. 2018 Jan 17;8(1):980 [PMID: 29343868]
  170. PLoS One. 2018 Mar 22;13(3):e0194870 [PMID: 29566059]
  171. J Immunol Res. 2018 Jan 31;2018:9517842 [PMID: 29651447]
  172. Fetal Pediatr Pathol. 2018 Jun;37(3):141-146 [PMID: 29693486]
  173. J Cell Sci. 2018 May 1;131(9):null [PMID: 29717004]
  174. Placenta. 2018 Jun;66:17-25 [PMID: 29884298]
  175. Immunology. 2018 Nov;155(3):379-386 [PMID: 29972692]
  176. Biochim Biophys Acta Mol Basis Dis. 2018 Dec 13;:null [PMID: 30553017]
  177. Front Immunol. 2019 Jan 10;9:3142 [PMID: 30687334]
  178. Nature. 1971 May 14;231(5298):116-7 [PMID: 4930089]
  179. Oncodev Biol Med. 1983;4(5):343-50 [PMID: 6856484]
  180. Glycobiology. 1995 Mar;5(2):255-61 [PMID: 7780201]
  181. Glycobiology. 1994 Oct;4(5):567-75 [PMID: 7881170]
  182. J Biol Chem. 1995 Mar 10;270(10):5207-12 [PMID: 7890631]
  183. Proc Natl Acad Sci U S A. 1994 Feb 15;91(4):1428-32 [PMID: 8108426]
  184. J Biol Chem. 1993 Dec 25;268(36):27034-8 [PMID: 8262940]
  185. Arch Biochem Biophys. 1993 Jan;300(1):6-17 [PMID: 8380972]
  186. Glycobiology. 1993 Aug;3(4):297-304 [PMID: 8400545]
  187. Glycobiology. 1993 Apr;3(2):97-130 [PMID: 8490246]
  188. Proc Natl Acad Sci U S A. 1996 Jun 25;93(13):6737-42 [PMID: 8692888]
  189. J Biochem. 1996 Jan;119(1):1-8 [PMID: 8907168]
  190. Placenta. 1997 Jul-Aug;18(5-6):433-9 [PMID: 9250706]
  191. Biochemistry. 1998 Apr 28;37(17):5867-77 [PMID: 9558320]
  192. Hum Reprod. 1998 Mar;13(3):730-5 [PMID: 9572443]
  193. J Biol Chem. 1998 May 22;273(21):13047-52 [PMID: 9582341]
  194. J Immunol. 1998 Jun 15;160(12):5922-8 [PMID: 9637505]
  195. Clin Sci (Lond). 1998 Aug;95(2):115-28 [PMID: 9680492]

Grants

  1. R01 GM070589/NIGMS NIH HHS
  2. R21 AI120918/NIAID NIH HHS

MeSH Term

Animals
Carbohydrate Sequence
Chromosome Mapping
Dimerization
Embryo, Nonmammalian
Embryonic Development
Endothelial Cells
Extracellular Vesicles
Female
Galectins
Glycosylation
Humans
Maternal-Fetal Exchange
Neovascularization, Physiologic
Placentation
Polysaccharides
Pre-Eclampsia
Pregnancy
Pregnancy Proteins
Protein Processing, Post-Translational
Structure-Activity Relationship
Substrate Specificity
Trophoblasts

Chemicals

Galectins
Polysaccharides
Pregnancy Proteins
Journal Article Research Support, N.I.H., Extramural Research Support, Non-U.S. Gov't Review
Article has an altmetric score of 1

Word Cloud

Created with Highcharts 10.0.0galectinspregnancyGalectinsplacentationregulatingrolephylogeneticallyconservedfamilysolubleβ-galactosidebindingproteinsconsisting15differenttypesspecificfunctioncontributetrophoblastdevelopmentmigrationinvasionearlyadditioncriticalplayersmaternalimmunetoleranceembeddedembryoRecentlyangiogenesisdecidualizationplacentaformationgainedattentionAlteredexpressionassociatedabnormalpregnanciesinfertilityreviewfocusespregnancy-associatedprocessesdiscussesrelevancegalectin-glycaninteractionspotentialtherapeutictargetsdisordersPregnancyGalectinology:InsightsComplexNetworkGlycanBindingProteinsglycanspreeclampsia

Similar Articles

Cited By