Detection of Metallothionein Proteins by Enzyme-Linked Immunosorbent Assay (ELISA).

Qingyun Jia, Hans-Uwe Dahms, Lan Wang
Author Information
  1. Qingyun Jia: School of Life Science, Shanxi University, Taiyuan 030006, China.
  2. Hans-Uwe Dahms: Department of Biomedical Science and Environmental Biology, Kaohsiung Medical University, Kaohsiung 80708, Taiwan.
  3. Lan Wang: School of Life Science, Shanxi University, Taiyuan 030006, China.

Abstract

Metallothioneins (MTs) are low-molecular-weight, cysteine-rich proteins that bind to heavy metals. MTs play a key role in the homeostasis of metal ions, maintaining intracellular redox equilibria and free radical scavenging. In several studies, under different conditions such as cancer development, drug therapy and heavy metal stress, the unique structural changes and functional effects of MT were studied. Although several assays are available to monitor the content and type of Metallothionein (MT) from environmental samples or in biomedical assays, Enzyme-Linked Immunosorbent Assays (ELISA) became the preferred method of MT detection. ELISA is low in cost, specific, simple, and efficient. This review evaluates the advantages and disadvantages of using different types of ELISA in the detection of metallothioneins from environmental or clinical samples as well as ways of its validation and cross-validation.

Keywords

MeSH Term

Animals
Environmental Exposure
Environmental Pollutants
Enzyme-Linked Immunosorbent Assay
Humans
Metallothionein
Metals, Heavy
Oxidation-Reduction
Protein Binding
Reproducibility of Results
Sensitivity and Specificity

Chemicals

Environmental Pollutants
Metals, Heavy
Metallothionein

Word Cloud

Created with Highcharts 10.0.0ELISAMTMetallothioneinenvironmentaldetectionMTsheavymetalseveraldifferentassayssamplesEnzyme-LinkedImmunosorbentclinicalcross-validationbiomarkerMetallothioneinslow-molecular-weightcysteine-richproteinsbindmetalsplaykeyrolehomeostasisionsmaintainingintracellularredoxequilibriafreeradicalscavengingstudiesconditionscancerdevelopmentdrugtherapystressuniquestructuralchangesfunctionaleffectsstudiedAlthoughavailablemonitorcontenttypebiomedicalAssaysbecamepreferredmethodlowcostspecificsimpleefficientreviewevaluatesadvantagesdisadvantagesusingtypesmetallothioneinswellwaysvalidationDetectionProteinsAssay

Similar Articles

Cited By