Overexpression of HPRT1 is associated with poor prognosis in head and neck squamous cell carcinoma.

Mohsen Ahmadi, Maryam Eftekhari Kenzerki, Seyed Mohammad Akrami, Salar Pashangzadeh, Fatemeh Hajiesmaeili, Sahereh Rahnavard, Leila Habibipour, Negin Saffarzadeh, Pegah Mousavi
Author Information
  1. Mohsen Ahmadi: Student Research Committee, Hormozgan University of Medical Sciences, Bandar Abbas, Iran. ORCID
  2. Maryam Eftekhari Kenzerki: Student Research Committee, Hormozgan University of Medical Sciences, Bandar Abbas, Iran.
  3. Seyed Mohammad Akrami: Department of Medical Genetics, School of Medicine, Tehran University of Medical Sciences, Iran.
  4. Salar Pashangzadeh: Iranian Research Center for HIV/AIDS, Iranian Institute for Reduction of High-Risk Behaviors, Tehran University of Medical Sciences, Iran.
  5. Fatemeh Hajiesmaeili: Division of Medical Genetics, Booali Medical Diagnostic Laboratory, Qom, Iran.
  6. Sahereh Rahnavard: Department of Cellular and Molecular Biology, Ahar Branch, Islamic Azad University, Ahar, Iran.
  7. Leila Habibipour: Molecular Medicine Research Center, Hormozgan Health Institute, Hormozgan University of Medical Sciences, Bandar Abbas, Iran.
  8. Negin Saffarzadeh: Department of Medical Genetics, School of Medicine, Tehran University of Medical Sciences, Iran.
  9. Pegah Mousavi: Department of Medical Genetics, Faculty of Medicine, Hormozgan University of Medical Sciences, Bandar Abbas, Iran.

Abstract

Hypoxanthine phosphoribosyltransferase (HPRT1), as a salvage pathway enzyme, plays a crucial role in modulating the cell cycle and has been reported to be overexpressed in multiple cancers. Nevertheless, the relationship between the HPRT1 gene and head and neck squamous cell carcinomas (HNSCCs) has not been investigated so far. In this study, we first evaluated the expression and clinical value of HPRT1 mRNA and protein in tumor and healthy control tissues. Then, we examined mutations of the HPRT1 gene and their association with survival outcomes of patients with HNSCC. We also performed functional analyses of HPRT1 coexpressed genes and examined the association between HPRT1 expression and drug sensitivity. Both HPRT1 mRNA and protein were significantly higher in HNSCC compared with normal tissues, and up-regulation of HPRT1 was also correlated with age, sex, pathological stage and histological grades of patients with HNSCC. Moreover, HPRT1 and its associated genes were observed to be enriched for several cancer-related pathways, including DNA replication and cell cycle. Finally, patients exhibiting overexpression of the HPRT1 gene may be resistant to abiraterone and sensitive to several drugs, including tozasertib and teniposide. This study demonstrated that the elevated expression of HPRT1 gene is correlated with the progression of HNSCC; thus, this gene may serve as a useful indicator for the early detection, risk stratification and targeted therapy of patients with HNSCC.

Keywords

References

  1. Mol Cell Oncol. 2018 Aug 1;5(4):e1481810 [PMID: 30250925]
  2. Front Oncol. 2019 Aug 29;9:827 [PMID: 31555588]
  3. Oncotarget. 2016 Nov 15;7(46):75379-75393 [PMID: 27683114]
  4. FEBS Open Bio. 2018 Jun 26;8(8):1280-1298 [PMID: 30087832]
  5. Oral Dis. 2021 Mar;27(2):204-214 [PMID: 32640108]
  6. Genome Biol. 2017 Dec 20;18(1):237 [PMID: 29262850]
  7. Science. 2017 Aug 18;357(6352): [PMID: 28818916]
  8. Nucleic Acids Res. 2007 Jan;35(Database issue):D760-5 [PMID: 17099226]
  9. Cell. 2017 Dec 14;171(7):1611-1624.e24 [PMID: 29198524]
  10. Front Immunol. 2018 Jul 30;9:1697 [PMID: 30105018]
  11. Clin Cancer Res. 2013 Jul 1;19(13):3416-28 [PMID: 23719266]
  12. Head Neck. 2019 Apr;41(4):993-1006 [PMID: 30582241]
  13. J Pathol. 2020 Jan;250(1):107-119 [PMID: 31465124]
  14. Cell Death Dis. 2019 Jul 15;10(8):540 [PMID: 31308358]
  15. Science. 2015 Jan 23;347(6220):1260419 [PMID: 25613900]
  16. Cancer Manag Res. 2020 Jun 23;12:4855-4869 [PMID: 32606974]
  17. Head Neck. 2019 Oct;41 Suppl 1:19-45 [PMID: 31573749]
  18. Int Immunopharmacol. 2015 Sep;28(1):208-14 [PMID: 26066298]
  19. Otolaryngol Head Neck Surg. 2020 Apr;162(4):446-457 [PMID: 32093572]
  20. Genomics. 1992 Jul;13(3):788-96 [PMID: 1639405]
  21. Lancet Oncol. 2019 Jun;20(6):e313-e326 [PMID: 31162105]
  22. PLoS One. 2013 Dec 18;8(12):e82241 [PMID: 24367507]
  23. Orphanet J Rare Dis. 2007 Dec 08;2:48 [PMID: 18067674]
  24. Science. 2017 May 26;356(6340): [PMID: 28495876]
  25. Cancers (Basel). 2019 Aug 05;11(8): [PMID: 31387228]
  26. Clin Cancer Res. 2016 Apr 15;22(8):2062-73 [PMID: 26603260]
  27. CA Cancer J Clin. 2011 Mar-Apr;61(2):69-90 [PMID: 21296855]
  28. Cancer Cell Int. 2020 Jun 8;20:220 [PMID: 32523426]
  29. Breast Cancer Res Treat. 2010 Oct;123(3):725-31 [PMID: 20020197]
  30. Cell Cycle. 2018;17(19-20):2386-2397 [PMID: 30328366]
  31. Cancers (Basel). 2019 May 17;11(5): [PMID: 31108873]
  32. Mol Cell Proteomics. 2019 Sep;18(9):1893-1898 [PMID: 31308250]
  33. Cancers (Basel). 2020 Jun 10;12(6): [PMID: 32532008]
  34. Cancers (Basel). 2019 Sep 12;11(9): [PMID: 31547393]
  35. Cancer Discov. 2012 May;2(5):401-4 [PMID: 22588877]
  36. Oncogenesis. 2019 Jun 17;8(7):38 [PMID: 31209198]
  37. Oncotarget. 2017 Dec 20;9(5):5797-5810 [PMID: 29464035]
  38. Front Mol Biosci. 2020 Apr 24;7:68 [PMID: 32391379]
  39. Biosci Rep. 2019 Jul 29;39(7): [PMID: 31324732]
  40. Cancer Manag Res. 2020 Feb 26;12:1427-1435 [PMID: 32161495]
  41. Nucleic Acids Res. 2017 Jan 4;45(D1):D777-D783 [PMID: 27899578]
  42. Adv Ther. 2018 Feb;35(2):153-160 [PMID: 29396681]
  43. Nucleic Acids Res. 2016 Jul 8;44(W1):W90-7 [PMID: 27141961]
  44. J Clin Lab Anal. 2020 Mar;34(3):e23107 [PMID: 31782831]
  45. Cancer Cell Int. 2019 Jan 21;19:19 [PMID: 30679932]
  46. BMC Cancer. 2019 Aug 23;19(1):830 [PMID: 31443700]
  47. Sci Signal. 2013 Apr 02;6(269):pl1 [PMID: 23550210]
  48. J Clin Invest. 2012 Jun;122(6):1951-7 [PMID: 22833868]
  49. Laryngoscope. 2019 Jan;129(1):146-153 [PMID: 30194774]
  50. CA Cancer J Clin. 2018 Nov;68(6):394-424 [PMID: 30207593]

MeSH Term

Biomarkers, Tumor
Computational Biology
DNA Mutational Analysis
Databases, Genetic
Drug Resistance, Neoplasm
Gene Expression
Gene Expression Profiling
Gene Expression Regulation, Neoplastic
Humans
Hypoxanthine Phosphoribosyltransferase
Mutation
RNA, Messenger
ROC Curve
Squamous Cell Carcinoma of Head and Neck

Chemicals

Biomarkers, Tumor
RNA, Messenger
Hypoxanthine Phosphoribosyltransferase

Word Cloud

Created with Highcharts 10.0.0HPRT1geneHNSCCcellpatientsheadneckexpressioncyclesquamousstudymRNAproteintissuesexaminedassociationalsogenescorrelatedassociatedseveralincludingmayHypoxanthinephosphoribosyltransferasesalvagepathwayenzymeplayscrucialrolemodulatingreportedoverexpressedmultiplecancersNeverthelessrelationshipcarcinomasHNSCCsinvestigatedfarfirstevaluatedclinicalvaluetumorhealthycontrolmutationssurvivaloutcomesperformedfunctionalanalysescoexpresseddrugsensitivitysignificantlyhighercomparednormalup-regulationagesexpathologicalstagehistologicalgradesMoreoverobservedenrichedcancer-relatedpathwaysDNAreplicationFinallyexhibitingoverexpressionresistantabirateronesensitivedrugstozasertibteniposidedemonstratedelevatedprogressionthusserveusefulindicatorearlydetectionriskstratificationtargetedtherapyOverexpressionpoorprognosiscarcinomaGEOTCGAbioinformaticsbiomarkercancer

Similar Articles

Cited By (18)