Bleeding diathesis in mice lacking JAK2 in platelets.

Nathan Eaton, Saravanan Subramaniam, Marie L Schulte, Caleb Drew, David Jakab, Sandra L Haberichter, Hartmut Weiler, Hervé Falet
Author Information
  1. Nathan Eaton: Versiti Blood Research Institute, Milwaukee, WI. ORCID
  2. Saravanan Subramaniam: Versiti Blood Research Institute, Milwaukee, WI. ORCID
  3. Marie L Schulte: Versiti Blood Research Institute, Milwaukee, WI.
  4. Caleb Drew: Versiti Blood Research Institute, Milwaukee, WI.
  5. David Jakab: Versiti Blood Research Institute, Milwaukee, WI.
  6. Sandra L Haberichter: Versiti Blood Research Institute, Milwaukee, WI. ORCID
  7. Hartmut Weiler: Versiti Blood Research Institute, Milwaukee, WI. ORCID
  8. Hervé Falet: Versiti Blood Research Institute, Milwaukee, WI. ORCID

Abstract

The tyrosine kinase JAK2 is a critical component of intracellular JAK/STAT cytokine signaling cascades that is prevalent in hematopoietic cells, such as hematopoietic stem cells and megakaryocytes (MKs). Individuals expressing the somatic JAK2 V617F mutation commonly develop myeloproliferative neoplasms (MPNs) associated with venous and arterial thrombosis, a leading cause of mortality. The role of JAK2 in hemostasis remains unclear. We investigated the role of JAK2 in platelet hemostatic function using Jak2fl/fl Pf4-Cre (Jak2Plt-/-) mice lacking JAK2 in platelets and MKs. Jak2Plt-/- mice developed MK hyperplasia and splenomegaly associated with severe thrombocytosis and bleeding. This notion was supported by failure to occlude in a ferric chloride carotid artery injury model and by a cremaster muscle laser-induced injury assay, in which Jak2Plt-/- platelets failed to form stable thrombi. Jak2Plt-/- platelets formed thrombi poorly after adhesion to type 1 collagen under arterial shear rates. Jak2Plt-/- platelets spread poorly on collagen under static conditions or on fibrinogen in response to the collagen receptor GPVI-specific agonist, collagen-related peptide (CRP). After activation with collagen, CRP, or the CLEC-2 agonist rhodocytin, Jak2Plt-/- platelets displayed decreased α-granule secretion and integrin αIIbβ3 activation or aggregation, but showed normal responses to thrombin. Jak2Plt-/- platelets had impaired intracellular signaling when activated via GPVI, as assessed by tyrosine phosphorylation. Together, the results show that JAK2 deletion impairs platelet immunoreceptor tyrosine-based activation motif signaling and hemostatic function in mice and suggest that aberrant JAK2 signaling in patients with MPNs affects GPVI signaling, leading to hemostatic platelet function.

References

  1. Blood. 2014 Oct 2;124(14):2280-4 [PMID: 25115888]
  2. Blood. 2013 Feb 14;121(7):1209-19 [PMID: 23243278]
  3. Circulation. 2002 Jul 9;106(2):266-72 [PMID: 12105169]
  4. Thromb Haemost. 2017 Dec;117(12):2322-2333 [PMID: 29212120]
  5. Blood. 2014 Aug 14;124(7):1062-9 [PMID: 24986690]
  6. Nat Commun. 2020 Jan 17;11(1):356 [PMID: 31953383]
  7. Haematologica. 2020 May;105(5):1414-1423 [PMID: 31296575]
  8. Blood. 2020 Nov 12;136(20):2346-2358 [PMID: 32640021]
  9. Blood. 1993 Sep 15;82(6):1749-57 [PMID: 8400231]
  10. Mol Cell Biol. 2004 Jun;24(12):5510-20 [PMID: 15169911]
  11. Oncogene. 2013 May 23;32(21):2601-13 [PMID: 22869151]
  12. Arterioscler Thromb Vasc Biol. 2020 Oct;40(10):e262-e272 [PMID: 32814440]
  13. Blood. 2015 Feb 5;125(6):1014-24 [PMID: 25468568]
  14. J Cell Sci. 2017 Nov 1;130(21):3764-3775 [PMID: 28954813]
  15. Leuk Lymphoma. 2010 Apr;51(4):576-82 [PMID: 20214447]
  16. PLoS Comput Biol. 2013 Apr;9(4):e1003022 [PMID: 23592968]
  17. Blood. 2014 Sep 25;124(13):2104-15 [PMID: 25143485]
  18. Blood. 2007 Feb 15;109(4):1503-6 [PMID: 17032923]
  19. J Biol Chem. 2005 Jul 22;280(29):27251-61 [PMID: 15899890]
  20. Thromb Res. 2014 Jun;133(6):1088-96 [PMID: 24731555]
  21. J Thromb Haemost. 2018 Mar;16(3):546-554 [PMID: 29285851]
  22. Semin Thromb Hemost. 2007 Jun;33(4):313-20 [PMID: 17525888]
  23. Br J Haematol. 2005 Feb;128(3):275-90 [PMID: 15667529]
  24. Proc Natl Acad Sci U S A. 2014 Apr 22;111(16):5884-9 [PMID: 24711413]
  25. Blood. 2000 Jun 1;95(11):3429-34 [PMID: 10828025]
  26. Arterioscler Thromb Vasc Biol. 2005 Jun;25(6):1293-8 [PMID: 15774906]
  27. Eur J Biochem. 2001 Oct;268(20):5242-8 [PMID: 11606185]
  28. Blood. 2013 Nov 28;122(23):3787-97 [PMID: 24085768]
  29. Lancet. 2005 Dec 3;366(9501):1945-53 [PMID: 16325696]
  30. Thromb Haemost. 2020 Feb;120(2):262-276 [PMID: 31901221]
  31. Platelets. 2017 Sep;28(6):567-575 [PMID: 27885904]
  32. J Thromb Haemost. 2005 Aug;3(8):1752-62 [PMID: 16102042]
  33. Thromb Res. 2009 Sep;124(4):409-17 [PMID: 19299003]
  34. J Cell Sci. 2004 Mar 15;117(Pt 8):1281-3 [PMID: 15020666]
  35. N Engl J Med. 2004 Jan 8;350(2):114-24 [PMID: 14711910]
  36. Blood. 2003 Jul 15;102(2):449-61 [PMID: 12649139]
  37. Blood. 2018 Mar 8;131(10):1106-1110 [PMID: 29295843]
  38. J Cell Mol Med. 2020 Nov;24(21):12491-12503 [PMID: 32954656]
  39. Haematologica. 2007 Jan;92(1):135-6 [PMID: 17229651]
  40. Blood. 2002 May 1;99(9):3228-34 [PMID: 11964287]
  41. Proc Natl Acad Sci U S A. 2014 Feb 11;111(6):2295-300 [PMID: 24469804]
  42. Blood. 2014 Aug 14;124(7):1136-45 [PMID: 24951423]
  43. Blood. 2012 May 17;119(20):4625-35 [PMID: 22378845]
  44. Leukemia. 2010 Jun;24(6):1128-38 [PMID: 20428194]
  45. Biochem J. 1996 May 15;316 ( Pt 1):93-8 [PMID: 8645238]
  46. Curr Protoc Mouse Biol. 2014 Dec 11;4(4):151-64 [PMID: 25723183]
  47. Genesis. 2004 Sep;40(1):52-7 [PMID: 15354294]

Grants

  1. R01 HL126743/NHLBI NIH HHS
  2. R01 HL133348/NHLBI NIH HHS
  3. R01 HL136430/NHLBI NIH HHS

MeSH Term

Animals
Blood Platelets
Disease Susceptibility
Hemorrhage
Hemostasis
Janus Kinase 2
Mice
Mice, Knockout
Platelet Activation
Platelet Membrane Glycoproteins
Thrombocytosis

Chemicals

Platelet Membrane Glycoproteins
Jak2 protein, mouse
Janus Kinase 2

Word Cloud

Created with Highcharts 10.0.0JAK2Jak2Plt-/-plateletssignalingmicecollagenplatelethemostaticfunctionactivationtyrosineintracellularhematopoieticcellsMKsMPNsassociatedarterialleadingrolelackinginjurythrombipoorlyagonistCRPGPVIkinasecriticalcomponentJAK/STATcytokinecascadesprevalentstemmegakaryocytesIndividualsexpressingsomaticV617FmutationcommonlydevelopmyeloproliferativeneoplasmsvenousthrombosiscausemortalityhemostasisremainsunclearinvestigatedusingJak2fl/flPf4-CredevelopedMKhyperplasiasplenomegalyseverethrombocytosisbleedingnotionsupportedfailureoccludeferricchloridecarotidarterymodelcremastermusclelaser-inducedassayfailedformstableformedadhesiontype1shearratesspreadstaticconditionsfibrinogenresponsereceptorGPVI-specificcollagen-relatedpeptideCLEC-2rhodocytindisplayeddecreasedα-granulesecretionintegrinαIIbβ3aggregationshowednormalresponsesthrombinimpairedactivatedviaassessedphosphorylationTogetherresultsshowdeletionimpairsimmunoreceptortyrosine-basedmotifsuggestaberrantpatientsaffectsBleedingdiathesis

Similar Articles

Cited By