The lncRNA H19/miR-766-3p/S1PR3 Axis Contributes to the Hyperproliferation of Keratinocytes and Skin Inflammation in Psoriasis via the AKT/mTOR Pathway.

Yuexi He, Xiran Yin, Jianjun Yan, Xue Li, Qing Sun
Author Information
  1. Yuexi He: Department of Dermatology, Qilu Hospital, Cheeloo College of Medicine, Shandong University, Jinan, Shandong 250012, China. ORCID
  2. Xiran Yin: Department of Dermatology, Qilu Hospital, Cheeloo College of Medicine, Shandong University, Jinan, Shandong 250012, China.
  3. Jianjun Yan: Department of Dermatology, Qilu Hospital, Cheeloo College of Medicine, Shandong University, Jinan, Shandong 250012, China.
  4. Xue Li: Department of Dermatology, Yantai Yuhuangding Hospital of Qingdao University, Yantai, Shandong 264000, China.
  5. Qing Sun: Department of Dermatology, Qilu Hospital, Cheeloo College of Medicine, Shandong University, Jinan, Shandong 250012, China. ORCID

Abstract

BACKGROUND: The pathogenesis of long noncoding RNAs (lncRNAs) and microRNAs (miRNAs) are well studied in psoriasis. However, little is known about how specific lncRNAs and miRNAs affect the mechanism of psoriasis development and which pathways are involved.
OBJECTIVES: To explore the role of the lncRNA H19/miR-766-3p/S1PR3 axis in psoriasis.
METHODS: miRNA and lncRNA microarrays were performed using IL-22-induced HaCaT cells and psoriatic lesions, respectively. Fluorescence hybridization and quantitative reverse-transcriptase polymerase chain reaction were used to detect the expression of miR-766-3p and lncRNA H19. Luciferase reporter assays were used to identify miR-766-3p/lncRNA H19 and miR-766-3p/S1PR3 combinations. CCK-8 and ELISA were performed to evaluate the proliferation of keratinocytes and the secretion of pro-inflammatory cytokines. Western blot analysis was used to detect the expression of S1PR3 and its downstream effector proteins.
RESULTS: MiR-766-3p was upregulated in both HaCaT cells treated with the psoriasis-related cytokine pool (IL-17A, IL-22, IL-1 alpha, oncostatin M, and TNF-alpha) and tissues. Overexpression of miR-766-3p promoted keratinocyte proliferation and IL-17A and IL-22 secretion. LncRNA H19 and S1PR3 were demonstrably combined with miR-766-3p by luciferase reporter assay. lncRNA H19 repressed proliferation and inflammation, which were reduced by the miR-766-3p. AKT/mTOR pathway effected proliferation and inflammation by the lncRNA H19/miR-766-3p/S1PR3 axis.
CONCLUSIONS: We established that downregulation of lncRNA H19 promoted the proliferation of keratinocytes and skin inflammation by up-regulating miR-766-3p expression levels and inhibiting activation of S1PR3 through the AKT/mTOR pathway in psoriasis.

References

  1. Adv Exp Med Biol. 2020;1253:209-221 [PMID: 32445097]
  2. Nat Rev Genet. 2009 Mar;10(3):155-9 [PMID: 19188922]
  3. Exp Dermatol. 2017 Apr;26(4):359-367 [PMID: 27783430]
  4. Cell Death Dis. 2017 Nov 30;8(11):e3174 [PMID: 29192645]
  5. Yonsei Med J. 2019 Apr;60(4):381-388 [PMID: 30900425]
  6. Exp Ther Med. 2019 Nov;18(5):4011-4021 [PMID: 31611939]
  7. Front Immunol. 2018 Nov 30;9:2786 [PMID: 30555471]
  8. Exp Cell Res. 2018 Feb 15;363(2):243-254 [PMID: 29339075]
  9. N Engl J Med. 2009 Jul 30;361(5):496-509 [PMID: 19641206]
  10. Pflugers Arch. 2016 Jun;468(6):935-43 [PMID: 26935426]
  11. Rheumatology (Oxford). 2021 Jan 5;60(1):430-440 [PMID: 32810279]
  12. Int J Mol Sci. 2019 Feb 14;20(4): [PMID: 30769772]
  13. Eur Rev Med Pharmacol Sci. 2017 Jan;21(2):322-328 [PMID: 28165553]
  14. Int J Cancer. 2017 Nov 1;141(9):1867-1878 [PMID: 28657135]
  15. Exp Dermatol. 2018 Feb;27(2):135-143 [PMID: 29105195]
  16. PLoS One. 2014 Jul 10;9(7):e101937 [PMID: 25010647]
  17. Biochem Biophys Res Commun. 2018 Apr 15;498(4):830-836 [PMID: 29534963]
  18. Biol Res. 2018 Sep 4;51(1):30 [PMID: 30180891]
  19. Mol Med Rep. 2019 May;19(5):3421-3430 [PMID: 30816535]
  20. J Invest Dermatol. 2016 Mar;136(3):603-609 [PMID: 27015450]
  21. J Cell Biochem. 2019 Mar;120(3):3874-3886 [PMID: 30474270]
  22. Exp Dermatol. 2017 Apr;26(4):368-374 [PMID: 27943426]
  23. Lancet. 2015 Sep 5;386(9997):983-94 [PMID: 26025581]
  24. PLoS One. 2018 Sep 7;13(9):e0203211 [PMID: 30192865]
  25. Inflammation. 2018 Mar;41(2):496-504 [PMID: 29181737]
  26. Exp Dermatol. 2019 Mar;28(3):283-291 [PMID: 30664260]
  27. JAMA. 2020 May 19;323(19):1945-1960 [PMID: 32427307]
  28. Nat Rev Genet. 2016 May;17(5):272-83 [PMID: 27040487]
  29. Biochim Biophys Acta Mol Cell Res. 2017 Oct;1864(10):1887-1899 [PMID: 28779971]
  30. Front Cell Dev Biol. 2019 Nov 01;7:263 [PMID: 31737629]
  31. Genomics. 2019 Dec;111(6):1862-1872 [PMID: 30543848]
  32. Cell. 2013 Mar 14;152(6):1298-307 [PMID: 23498938]
  33. Cell Res. 2012 Mar;22(3):504-15 [PMID: 21862971]
  34. Rheum Dis Clin North Am. 2015 Nov;41(4):665-75 [PMID: 26476225]
  35. Arterioscler Thromb Vasc Biol. 2012 Apr;32(4):955-61 [PMID: 22308044]
  36. Nat Commun. 2018 Nov 5;9(1):4624 [PMID: 30397197]
  37. Cancer Biol Ther. 2016 Nov;17(11):1126-1138 [PMID: 27668319]
  38. Br J Dermatol. 2019 Feb;180(2):365-372 [PMID: 30269330]

MeSH Term

Cell Proliferation
Humans
In Situ Hybridization, Fluorescence
Inflammation
Keratinocytes
MicroRNAs
Proto-Oncogene Proteins c-akt
Psoriasis
RNA, Long Noncoding
Sphingosine-1-Phosphate Receptors
TOR Serine-Threonine Kinases

Chemicals

H19 long non-coding RNA
MIRN766 microRNA, human
MicroRNAs
RNA, Long Noncoding
Sphingosine-1-Phosphate Receptors
sphingosine-1-phosphate receptor-3, human
MTOR protein, human
Proto-Oncogene Proteins c-akt
TOR Serine-Threonine Kinases

Word Cloud

Created with Highcharts 10.0.0lncRNAmiR-766-3pH19proliferationpsoriasisH19/miR-766-3p/S1PR3usedexpressionS1PR3inflammationAKT/mTORlncRNAsmiRNAsaxisperformedHaCaTcellsdetectreporterkeratinocytessecretionIL-17AIL-22promotedpathwayBACKGROUND:pathogenesislongnoncodingRNAsmicroRNAswellstudiedHoweverlittleknownspecificaffectmechanismdevelopmentpathwaysinvolvedOBJECTIVES:exploreroleMETHODS:miRNAmicroarraysusingIL-22-inducedpsoriaticlesionsrespectivelyFluorescencehybridizationquantitativereverse-transcriptasepolymerasechainreactionLuciferaseassaysidentifymiR-766-3p/lncRNAmiR-766-3p/S1PR3combinationsCCK-8ELISAevaluatepro-inflammatorycytokinesWesternblotanalysisdownstreameffectorproteinsRESULTS:MiR-766-3pupregulatedtreatedpsoriasis-relatedcytokinepoolIL-1alphaoncostatinMTNF-alphatissuesOverexpressionkeratinocyteLncRNAdemonstrablycombinedluciferaseassayrepressedreducedeffectedCONCLUSIONS:establisheddownregulationskinup-regulatinglevelsinhibitingactivationAxisContributesHyperproliferationKeratinocytesSkinInflammationPsoriasisviaPathway

Similar Articles

Cited By