On-demand biomanufacturing through synthetic biology approach.

Chenwang Tang, Lin Wang, Lei Zang, Qing Wang, Dianpeng Qi, Zhuojun Dai
Author Information
  1. Chenwang Tang: MIIT Key Laboratory of Critical Materials Technology for New Energy Conversion and Storage; National and Local Joint Engineering Laboratory for Synthesis, Transformation and Separation of Extreme Environmental Nutrients, School of Chemistry and Chemical Engineering, Harbin Institute of Technology, Harbin, 150001, China.
  2. Lin Wang: Materials Synthetic Biology Center, CAS Key Laboratory of Quantitative Engineering Biology, Guangdong Provincial Key Laboratory of Synthetic Genomics, Shenzhen Institute of Synthetic Biology, Shenzhen Institutes of Advanced Technology, Chinese Academy of Sciences, Shenzhen, 518055, China.
  3. Lei Zang: Materials Synthetic Biology Center, CAS Key Laboratory of Quantitative Engineering Biology, Guangdong Provincial Key Laboratory of Synthetic Genomics, Shenzhen Institute of Synthetic Biology, Shenzhen Institutes of Advanced Technology, Chinese Academy of Sciences, Shenzhen, 518055, China.
  4. Qing Wang: Materials Synthetic Biology Center, CAS Key Laboratory of Quantitative Engineering Biology, Guangdong Provincial Key Laboratory of Synthetic Genomics, Shenzhen Institute of Synthetic Biology, Shenzhen Institutes of Advanced Technology, Chinese Academy of Sciences, Shenzhen, 518055, China.
  5. Dianpeng Qi: MIIT Key Laboratory of Critical Materials Technology for New Energy Conversion and Storage; National and Local Joint Engineering Laboratory for Synthesis, Transformation and Separation of Extreme Environmental Nutrients, School of Chemistry and Chemical Engineering, Harbin Institute of Technology, Harbin, 150001, China.
  6. Zhuojun Dai: Materials Synthetic Biology Center, CAS Key Laboratory of Quantitative Engineering Biology, Guangdong Provincial Key Laboratory of Synthetic Genomics, Shenzhen Institute of Synthetic Biology, Shenzhen Institutes of Advanced Technology, Chinese Academy of Sciences, Shenzhen, 518055, China.

Abstract

Biopharmaceuticals including protein therapeutics, engineered protein-based vaccines and monoclonal antibodies, are currently the mainstay products of the biotechnology industry. However, the need for specialized equipment and refrigeration during production and distribution poses challenges for the delivery of these technologies to the field and low-resource area. With the development of synthetic biology, multiple studies rewire the cell-free system or living cells to impact the portable, on-site and on-demand manufacturing of biomolecules. Here, we review these efforts and suggest future directions.

Keywords

References

  1. Trends Biotechnol. 2013 Mar;31(3):147-54 [PMID: 23178074]
  2. Biotechnol Biofuels. 2020 May 06;13:82 [PMID: 32391082]
  3. Cell. 2014 Nov 6;159(4):940-54 [PMID: 25417167]
  4. Metab Eng. 2018 Jul;48:138-149 [PMID: 29864583]
  5. Nat Biotechnol. 2001 Aug;19(8):751-5 [PMID: 11479568]
  6. Metab Eng. 2018 Jul;48:163-174 [PMID: 29883802]
  7. Nat Biotechnol. 2014 Oct;32(10):992-1000 [PMID: 25299917]
  8. Cell. 2014 Nov 6;159(4):718-20 [PMID: 25417149]
  9. Chembiochem. 2006 Mar;7(3):471-7 [PMID: 16511823]
  10. Proc Natl Acad Sci U S A. 2013 Jan 22;110(4):1249-54 [PMID: 23297225]
  11. Biologicals. 2014 Sep;42(5):237-59 [PMID: 24996452]
  12. Bioorg Med Chem Lett. 2015 Sep 1;25(17):3658-60 [PMID: 26130409]
  13. Nat Rev Genet. 2020 Mar;21(3):151-170 [PMID: 31780816]
  14. Appl Microbiol Biotechnol. 2018 Feb;102(3):1523-1531 [PMID: 29143082]
  15. PDA J Pharm Sci Technol. 2014 Jul-Aug;68(4):312 [PMID: 25035252]
  16. Nat Commun. 2020 Oct 14;11(1):5174 [PMID: 33057059]
  17. ACS Synth Biol. 2012 Feb 17;1(2):43-52 [PMID: 22737598]
  18. Metab Eng. 2020 Jul;60:37-44 [PMID: 32224263]
  19. Nat Rev Microbiol. 2013 Jan;11(1):33-44 [PMID: 23202530]
  20. Biochim Biophys Acta. 2004 Nov 11;1694(1-3):299-310 [PMID: 15546673]
  21. Microb Cell Fact. 2009 Mar 24;8:17 [PMID: 19317892]
  22. Curr Opin Biotechnol. 2019 Oct;59:175-181 [PMID: 31470258]
  23. Expert Rev Vaccines. 2014 Jul;13(7):843-54 [PMID: 24865112]
  24. Biochemistry. 2006 Dec 26;45(51):15444-57 [PMID: 17176066]
  25. Synth Syst Biotechnol. 2017 Mar 03;2(1):23-27 [PMID: 29062958]
  26. J Microbiol Biotechnol. 2015 Jul;25(7):953-62 [PMID: 25737124]
  27. Nat Biotechnol. 2018 Oct 01;: [PMID: 30272677]
  28. Nat Protoc. 2015 Sep;10(9):1328-44 [PMID: 26270393]
  29. Nat Commun. 2020 Feb 4;11(1):563 [PMID: 32019917]
  30. Nature. 2000 Jan 20;403(6767):335-8 [PMID: 10659856]
  31. Microb Cell Fact. 2016 Feb 09;15:33 [PMID: 26861699]
  32. ACS Synth Biol. 2014 Jul 18;3(7):432-8 [PMID: 24350980]
  33. Biotechnol Adv. 2012 Sep-Oct;30(5):1185-94 [PMID: 22008973]
  34. ACS Synth Biol. 2012 Sep 21;1(9):408-13 [PMID: 23651338]
  35. Curr Opin Biotechnol. 2013 Dec;24(6):1094-101 [PMID: 23522654]
  36. FEMS Microbiol Rev. 2012 Jan;36(1):131-48 [PMID: 22091839]
  37. Metab Eng. 2018 Nov;50:109-121 [PMID: 29775652]
  38. Sci Adv. 2021 Feb 3;7(6): [PMID: 33536221]
  39. ACS Synth Biol. 2019 Feb 15;8(2):455-462 [PMID: 30632751]
  40. Appl Environ Microbiol. 2020 Apr 1;86(8): [PMID: 32060024]
  41. Nat Chem Biol. 2018 Jun;14(6):627-635 [PMID: 29736039]
  42. Nat Commun. 2019 Nov 27;10(1):5404 [PMID: 31776339]
  43. Bioact Mater. 2021 Jan 27;6(8):2390-2399 [PMID: 33553823]
  44. Vaccine. 2017 Apr 19;35(17):2217-2223 [PMID: 27670076]
  45. J Med Microbiol. 2003 Oct;52(Pt 10):845-851 [PMID: 12972577]
  46. Proc Natl Acad Sci U S A. 2016 Jun 28;113(26):E3609-18 [PMID: 27274048]
  47. Nat Commun. 2022 Jul 5;13(1):3879 [PMID: 35790722]
  48. Nature. 2000 Jan 20;403(6767):339-42 [PMID: 10659857]
  49. BioDrugs. 2020 Jun;34(3):327-348 [PMID: 32198631]
  50. Nat Chem Biol. 2019 Oct;15(10):1017-1024 [PMID: 31527836]
  51. Cell. 2016 Sep 22;167(1):248-259.e12 [PMID: 27662092]
  52. Nat Commun. 2016 Jul 29;7:12211 [PMID: 27470089]
  53. Curr Opin Biotechnol. 2017 Jun;45:69-75 [PMID: 28226291]
  54. Comput Struct Biotechnol J. 2016 Jul 05;14:309-18 [PMID: 27570613]
  55. Nat Commun. 2018 Jan 8;9(1):77 [PMID: 29311542]
  56. Nat Commun. 2020 Dec 11;11(1):6379 [PMID: 33311504]
  57. J Ind Microbiol Biotechnol. 2013 Apr;40(3-4):257-74 [PMID: 23385853]
  58. Nat Biotechnol. 2017 Jun;35(6):507-513 [PMID: 28581491]
  59. Curr Opin Biotechnol. 2019 Apr;56:18-29 [PMID: 30138794]
  60. Mol Biotechnol. 2002 Sep;22(1):87-98 [PMID: 12353915]
  61. PLoS One. 2016 Apr 29;11(4):e0154614 [PMID: 27128597]
  62. Nat Chem Biol. 2020 Feb;16(2):126-133 [PMID: 31792444]
  63. Biophys Chem. 2019 Nov;254:106244 [PMID: 31446252]
  64. Environ Microbiol Rep. 2014 Jun;6(3):212-25 [PMID: 24983526]
  65. Front Bioeng Biotechnol. 2019 Oct 11;7:248 [PMID: 31681738]
  66. Curr Opin Biotechnol. 2006 Oct;17(5):548-57 [PMID: 16978856]
  67. Mol Biotechnol. 2019 May;61(5):365-384 [PMID: 30805909]
  68. Chembiochem. 2015 Nov;16(17):2420-31 [PMID: 26478227]
  69. Nat Chem Biol. 2018 Jan;14(1):29-35 [PMID: 29131146]
  70. Curr Protoc Protein Sci. 2010 Aug;Chapter 5:5.24.1-5.24.29 [PMID: 20814932]
  71. Nat Rev Microbiol. 2014 May;12(5):381-90 [PMID: 24686414]
  72. Nat Rev Genet. 2010 May;11(5):367-79 [PMID: 20395970]
  73. Nat Biotechnol. 2002 Aug;20(8):777-9 [PMID: 12148000]
  74. Nat Commun. 2018 Jul 12;9(1):2686 [PMID: 30002445]

Word Cloud

Created with Highcharts 10.0.0biologysyntheticsystemOn-demandBiopharmaceuticalsincludingproteintherapeuticsengineeredprotein-basedvaccinesmonoclonalantibodiescurrentlymainstayproductsbiotechnologyindustryHoweverneedspecializedequipmentrefrigerationproductiondistributionposeschallengesdeliverytechnologiesfieldlow-resourceareadevelopmentmultiplestudiesrewirecell-freelivingcellsimpactportableon-siteon-demandmanufacturingbiomoleculesrevieweffortssuggestfuturedirectionsbiomanufacturingapproachBiomanufacturingCell-freeEngineeredmicroorganismsPortabilitySynthetic

Similar Articles

Cited By (4)