Polymeric Micellar Systems-A Special Emphasis on "Smart" Drug Delivery.

Irina Negut, Bogdan Bita
Author Information
  1. Irina Negut: National Institute for Laser, Plasma and Radiation Physics, 409 Atomistilor Street, Magurele, 077125 Bucharest, Romania. ORCID
  2. Bogdan Bita: National Institute for Laser, Plasma and Radiation Physics, 409 Atomistilor Street, Magurele, 077125 Bucharest, Romania. ORCID

Abstract

Concurrent developments in anticancer nanotechnological treatments have been observed as the burden of cancer increases every year. The 21st century has seen a transformation in the study of medicine thanks to the advancement in the field of material science and nanomedicine. Improved drug delivery systems with proven efficacy and fewer side effects have been made possible. Nanoformulations with varied functions are being created using lipids, polymers, and inorganic and peptide-based nanomedicines. Therefore, thorough knowledge of these intelligent nanomedicines is crucial for developing very promising drug delivery systems. Polymeric micelles are often simple to make and have high solubilization characteristics; as a result, they seem to be a promising alternative to other nanosystems. Even though recent studies have provided an overview of polymeric micelles, here we included a discussion on the "intelligent" drug delivery from these systems. We also summarized the state-of-the-art and the most recent developments of polymeric micellar systems with respect to cancer treatments. Additionally, we gave significant attention to the clinical translation potential of polymeric micellar systems in the treatment of various cancers.

Keywords

References

  1. Innovation (Camb). 2021 Oct 14;2(4):100174 [PMID: 34766099]
  2. 3 Biotech. 2020 Apr;10(4):147 [PMID: 32181109]
  3. Oncologist. 2019 Jun;24(6):751-e231 [PMID: 30796155]
  4. Eur J Pharm Sci. 2016 Feb 15;83:184-202 [PMID: 26747018]
  5. J Biomater Sci Polym Ed. 2022 Dec;33(17):2185-2201 [PMID: 35796690]
  6. Polym Chem. 2017 Sep 14;8(34):4983-4987 [PMID: 28959359]
  7. Chem Eng J. 2021 May 1;411: [PMID: 37304676]
  8. Colloids Surf B Biointerfaces. 2017 Sep 1;157:398-406 [PMID: 28624725]
  9. 3 Biotech. 2019 Nov;9(11):415 [PMID: 31696020]
  10. Biotechnol Adv. 2015 Nov 1;33(6 Pt 3):1380-92 [PMID: 25597531]
  11. Curr Opin Biotechnol. 2022 Aug;76:102751 [PMID: 35777077]
  12. Curr Pharm Biotechnol. 2016;17(3):227-36 [PMID: 26873075]
  13. Polymers (Basel). 2022 Jan 20;14(3): [PMID: 35160394]
  14. Biomacromolecules. 2017 Nov 13;18(11):3665-3677 [PMID: 28880549]
  15. Photodiagnosis Photodyn Ther. 2022 Sep;39:102915 [PMID: 35597441]
  16. Nat Rev Drug Discov. 2021 Feb;20(2):101-124 [PMID: 33277608]
  17. Artif Cells Nanomed Biotechnol. 2018 Sep;46(6):1132-1140 [PMID: 28783976]
  18. Chem Soc Rev. 2016 Aug 22;45(17):4690-707 [PMID: 27188322]
  19. Front Pharmacol. 2021 Jun 18;12:679610 [PMID: 34220512]
  20. J Control Release. 2017 Sep 10;261:352-366 [PMID: 28163211]
  21. Nanoscale Res Lett. 2018 Oct 25;13(1):339 [PMID: 30361809]
  22. RSC Adv. 2022 Feb 8;12(8):4681-4691 [PMID: 35425510]
  23. Pharm Dev Technol. 2020 Apr;25(4):492-509 [PMID: 31903817]
  24. Bioconjug Chem. 2017 Aug 16;28(8):2190-2198 [PMID: 28661654]
  25. Signal Transduct Target Ther. 2020 Jul 2;5(1):113 [PMID: 32616710]
  26. Polymers (Basel). 2022 Nov 23;14(23): [PMID: 36501481]
  27. Biomater Sci. 2017 Feb 28;5(3):532-550 [PMID: 28124699]
  28. J Drug Target. 2017 Apr;25(4):285-295 [PMID: 27701892]
  29. React Funct Polym. 2021 Jan;158: [PMID: 33716552]
  30. Pharm Res. 2010 Dec;27(12):2569-89 [PMID: 20725771]
  31. Nanomedicine (Lond). 2017 Apr;12(8):941-952 [PMID: 28338410]
  32. J Phys Chem B. 2019 Oct 24;123(42):8923-8930 [PMID: 31566375]
  33. J Control Release. 2021 Apr 10;332:127-147 [PMID: 33609621]
  34. Drug Dev Ind Pharm. 2021 Jun;47(6):839-856 [PMID: 34033496]
  35. Chem Soc Rev. 2023 Jan 3;52(1):30-46 [PMID: 36511945]
  36. Int J Nanomedicine. 2018 Jun 15;13:3467-3480 [PMID: 29942129]
  37. Int J Pharm. 2020 May 30;582:119305 [PMID: 32278056]
  38. J Control Release. 2016 Mar 10;225:64-74 [PMID: 26806789]
  39. Polymers (Basel). 2016 Oct 27;8(11): [PMID: 30974657]
  40. Polymers (Basel). 2022 Nov 10;14(22): [PMID: 36432965]
  41. ACS Appl Mater Interfaces. 2021 Feb 24;13(7):8060-8070 [PMID: 33576220]
  42. Bioconjug Chem. 2022 Feb 16;33(2):411-417 [PMID: 35090123]
  43. Adv Drug Deliv Rev. 2019 Jan 1;138:133-147 [PMID: 30321619]
  44. Curr Biol. 2016 Nov 7;26(21):R1161-R1166 [PMID: 27825457]
  45. Int J Biol Macromol. 2022 Jun 15;210:565-578 [PMID: 35513093]
  46. Nanomaterials (Basel). 2018 Nov 13;8(11): [PMID: 30428608]
  47. Polymers (Basel). 2022 Jun 20;14(12): [PMID: 35746086]
  48. J Am Chem Soc. 2021 Jan 20;143(2):538-559 [PMID: 33370092]
  49. Nanomedicine (Lond). 2022 May;17(12):881-911 [PMID: 35332783]
  50. Food Chem Toxicol. 2022 Oct;168:113307 [PMID: 35917955]
  51. Int J Nanomedicine. 2018 May 18;13:2921-2942 [PMID: 29849457]
  52. J Control Release. 2017 Feb 28;248:96-116 [PMID: 28087407]
  53. Anal Chim Acta. 2022 Jun 29;1214:339965 [PMID: 35649645]
  54. Biomaterials. 2018 Sep;176:1-12 [PMID: 29842986]
  55. ACS Appl Bio Mater. 2019 Nov 18;2(11):5099-5109 [PMID: 35021452]
  56. Nano Res. 2018 Oct;11(10):4985-4998 [PMID: 30370014]
  57. Ther Deliv. 2020 Oct;11(10):613-635 [PMID: 32933425]
  58. Colloids Surf B Biointerfaces. 2018 Apr 1;164:58-69 [PMID: 29413621]
  59. ACS Nano. 2018 Nov 27;12(11):10636-10664 [PMID: 30335963]
  60. Polymers (Basel). 2019 May 07;11(5): [PMID: 31067730]
  61. Drug Deliv Transl Res. 2023 Jan;13(1):135-163 [PMID: 35727533]
  62. Pharmaceutics. 2022 Nov 24;14(12): [PMID: 36559088]
  63. Nanomedicine (Lond). 2016 Mar;11(6):673-92 [PMID: 27003448]
  64. Nat Mater. 2013 Nov;12(11):991-1003 [PMID: 24150417]
  65. ACS Appl Mater Interfaces. 2019 Apr 24;11(16):14647-14659 [PMID: 30933478]
  66. Pharmaceutics. 2022 Sep 03;14(9): [PMID: 36145608]
  67. Front Bioeng Biotechnol. 2018 Aug 13;6:110 [PMID: 30159310]
  68. J Nanobiotechnology. 2021 Jan 7;19(1):14 [PMID: 33413405]
  69. Curr Drug Metab. 2017;18(1):16-29 [PMID: 27654898]
  70. Acta Biomater. 2019 Apr 1;88:357-369 [PMID: 30822554]
  71. Oncotarget. 2018 Aug 24;9(66):32556-32569 [PMID: 30220965]
  72. Drug Deliv Transl Res. 2023 May;13(5):1195-1211 [PMID: 35816231]
  73. Artif Cells Nanomed Biotechnol. 2019 Dec;47(1):1476-1487 [PMID: 31070063]
  74. Curr Drug Metab. 2022;23(9):708-722 [PMID: 35713127]
  75. Nat Commun. 2019 Apr 12;10(1):1704 [PMID: 30979885]
  76. Int J Pharm. 2019 Aug 15;567:118485 [PMID: 31260781]
  77. Adv Mater. 2018 Aug;30(32):e1802373 [PMID: 29956381]
  78. Colloids Surf B Biointerfaces. 2019 Jun 1;178:412-420 [PMID: 30903980]
  79. Mater Sci Eng C Mater Biol Appl. 2020 Sep;114:111069 [PMID: 32994015]
  80. Biochim Biophys Acta Rev Cancer. 2020 Jan;1873(1):188319 [PMID: 31678141]
  81. Cancer Metastasis Rev. 2022 Jun;41(2):383-404 [PMID: 35366154]
  82. RSC Adv. 2019 Jan 18;9(5):2371-2378 [PMID: 35520478]
  83. Med One. 2019;4: [PMID: 31592196]
  84. Int J Pharm. 2021 Oct 25;608:121052 [PMID: 34500056]
  85. J Nanobiotechnology. 2020 Jan 15;18(1):13 [PMID: 31941501]
  86. Chem Soc Rev. 2022 Feb 7;51(3):995-1044 [PMID: 35005750]
  87. ACS Biomater Sci Eng. 2019 May 13;5(5):2258-2270 [PMID: 33405777]
  88. Natl Sci Rev. 2020 Apr;7(4):723-736 [PMID: 34692091]
  89. J Mater Chem B. 2018 Jun 7;6(21):3531-3540 [PMID: 32254448]
  90. ACS Appl Mater Interfaces. 2018 Jun 6;10(22):18489-18498 [PMID: 29737837]
  91. Chem Commun (Camb). 2017 Jan 19;53(7):1233-1236 [PMID: 27995230]
  92. Adv Drug Deliv Rev. 2020;156:80-118 [PMID: 32980449]
  93. ACS Nano. 2020 Mar 24;14(3):3075-3095 [PMID: 32078303]
  94. Pharmaceutics. 2022 Aug 05;14(8): [PMID: 36015262]
  95. Adv Healthc Mater. 2021 May;10(10):e2002163 [PMID: 33763992]
  96. J Nanopart Res. 2022;24(11):228 [PMID: 36373057]
  97. Carbohydr Polym. 2020 Oct 1;245:116527 [PMID: 32718631]
  98. J Colloid Interface Sci. 2018 Mar 15;514:468-478 [PMID: 29289031]
  99. Anal Chem. 2019 Oct 1;91(19):12369-12376 [PMID: 31434478]
  100. Colloids Surf B Biointerfaces. 2020 Sep;193:111067 [PMID: 32388121]
  101. Nanoscale. 2018 Feb 8;10(6):2923-2935 [PMID: 29369319]
  102. J Biomater Sci Polym Ed. 2020 Nov;31(16):2078-2093 [PMID: 32643545]
  103. J Control Release. 2021 Apr 10;332:312-336 [PMID: 33652113]
  104. J Control Release. 2022 May;345:709-720 [PMID: 35367476]
  105. J Physiol Biochem. 2022 Nov;78(4):739-752 [PMID: 35870078]
  106. J Control Release. 2019 May 10;301:28-41 [PMID: 30844476]
  107. Int J Pharm. 2022 Apr 5;617:121622 [PMID: 35227805]
  108. ACS Appl Mater Interfaces. 2017 Aug 9;9(31):25706-25716 [PMID: 28741924]
  109. Wiley Interdiscip Rev Nanomed Nanobiotechnol. 2015 Sep-Oct;7(5):691-707 [PMID: 25683687]
  110. Drug Deliv. 2022 Dec;29(1):792-806 [PMID: 35261298]
  111. Pharmaceutics. 2019 Apr 11;11(4): [PMID: 30978912]
  112. Macromol Rapid Commun. 2018 Oct;39(20):e1800139 [PMID: 29770519]
  113. IEEE Trans Nanobioscience. 2017 Dec;16(8):764-772 [PMID: 28976319]
  114. J Control Release. 2021 Nov 10;339:114-129 [PMID: 34536448]
  115. Nat Rev Mater. 2023;8(4):282-300 [PMID: 36691401]
  116. Eur J Pharmacol. 2021 Mar 5;894:173814 [PMID: 33352182]
  117. Adv Pharm Bull. 2017 Apr;7(1):11-20 [PMID: 28507933]
  118. Biomacromolecules. 2021 May 10;22(5):2043-2056 [PMID: 33835793]
  119. Mol Biol Rep. 2022 Sep;49(9):8907-8924 [PMID: 35347544]
  120. Adv Mater. 2020 Apr;32(13):e1902604 [PMID: 31353770]
  121. ACS Appl Mater Interfaces. 2022 May 11;14(18):20551-20565 [PMID: 35476401]
  122. J Control Release. 2017 Aug 10;259:62-75 [PMID: 28153760]
  123. Theranostics. 2016 Jun 07;6(9):1306-23 [PMID: 27375781]
  124. Nat Commun. 2021 Jun 17;12(1):3721 [PMID: 34140497]
  125. Theranostics. 2018 Jul 16;8(15):4097-4115 [PMID: 30128039]
  126. Biomaterials. 2018 Mar;157:136-148 [PMID: 29268144]
  127. Int J Nanomedicine. 2017 Aug 16;12:5879-5892 [PMID: 28860754]
  128. Polymers (Basel). 2021 Feb 02;13(3): [PMID: 33540922]
  129. Polymers (Basel). 2022 Nov 03;14(21): [PMID: 36365696]
  130. Pharm Res. 2014 Apr;31(4):1032-45 [PMID: 24154802]
  131. Colloids Surf B Biointerfaces. 2019 May 1;177:149-159 [PMID: 30721791]
  132. ACS Appl Mater Interfaces. 2017 Mar 1;9(8):6865-6877 [PMID: 28112512]
  133. J Control Release. 2020 Dec 10;328:970-984 [PMID: 32926885]
  134. Mater Sci Eng C Mater Biol Appl. 2020 Mar;108:110418 [PMID: 31924030]
  135. Artif Cells Nanomed Biotechnol. 2018 Aug;46(5):873-884 [PMID: 28830262]
  136. Adv Drug Deliv Rev. 2022 Sep;188:114463 [PMID: 35905947]
  137. ACS Pharmacol Transl Sci. 2020 Dec 04;4(1):240-247 [PMID: 33615176]
  138. ACS Appl Mater Interfaces. 2018 May 30;10(21):17672-17684 [PMID: 29737828]
  139. J Hazard Mater. 2019 Apr 15;368:630-637 [PMID: 30721858]
  140. Chem Soc Rev. 2017 Jul 17;46(14):4218-4244 [PMID: 28585944]
  141. Acta Biomater. 2020 Sep 1;113:501-511 [PMID: 32562805]
  142. Colloids Surf B Biointerfaces. 2017 Oct 1;158:507-517 [PMID: 28738290]
  143. Nanoscale. 2021 May 27;13(20):9236-9251 [PMID: 33977943]
  144. Biomacromolecules. 2022 Nov 14;23(11):4586-4596 [PMID: 36103674]
  145. Polymers (Basel). 2020 Jun 28;12(7): [PMID: 32605272]
  146. Nano Lett. 2019 Sep 11;19(9):6124-6132 [PMID: 31389705]
  147. Chem Commun (Camb). 2017 Mar 30;53(27):3822-3825 [PMID: 28317987]
  148. J Mater Chem B. 2019 Jan 14;7(2):334-345 [PMID: 32254558]
  149. Chemosphere. 2022 May;294:133779 [PMID: 35114262]
  150. Cancers (Basel). 2018 Jul 20;10(7): [PMID: 30037052]
  151. Langmuir. 2018 Jul 31;34(30):8875-8886 [PMID: 29983075]
  152. Curr Pharm Des. 2022;28(11):910-921 [PMID: 34879797]
  153. Nanoscale. 2018 Jul 9;10(26):12386-12397 [PMID: 29926047]
  154. J Control Release. 2002 Aug 21;82(2-3):359-71 [PMID: 12175749]
  155. J Control Release. 2021 Jun 10;334:303-317 [PMID: 33933517]
  156. Macromol Rapid Commun. 2019 Jan;40(2):e1800510 [PMID: 30176080]
  157. Drug Discov Today. 2022 May;27(5):1495-1512 [PMID: 35158056]
  158. ACS Appl Mater Interfaces. 2017 Sep 27;9(38):32520-32533 [PMID: 28870072]
  159. J Control Release. 2021 Jun 10;334:64-95 [PMID: 33887283]
  160. J Hazard Mater. 2018 Feb 5;343:86-97 [PMID: 28946135]
  161. Tissue Eng Part A. 2019 Mar;25(5-6):416-426 [PMID: 30132374]
  162. Front Biosci (Schol Ed). 2016 Jan 01;8(1):129-42 [PMID: 26709903]
  163. Ther Deliv. 2017 Feb;8(2):89-107 [PMID: 28088880]

Word Cloud

Created with Highcharts 10.0.0systemsdrugdeliverymicellespolymericdevelopmentstreatmentscancernanomedicinespromisingPolymericrecentmicellarConcurrentanticancernanotechnologicalobservedburdenincreaseseveryyear21stcenturyseentransformationstudymedicinethanksadvancementfieldmaterialsciencenanomedicineImprovedprovenefficacyfewersideeffectsmadepossibleNanoformulationsvariedfunctionscreatedusinglipidspolymersinorganicpeptide-basedThereforethoroughknowledgeintelligentcrucialdevelopingoftensimplemakehighsolubilizationcharacteristicsresultseemalternativenanosystemsEventhoughstudiesprovidedoverviewincludeddiscussion"intelligent"alsosummarizedstate-of-the-artrespectAdditionallygavesignificantattentionclinicaltranslationpotentialtreatmentvariouscancersMicellarSystems-ASpecialEmphasis"Smart"DrugDeliveryanti-cancerdrugsstimuli-responsive

Similar Articles

Cited By