Peripheral Biomarkers in Manifest and Premanifest Huntington's Disease.

Emanuele Morena, Carmela Romano, Martina Marconi, Selene Diamant, Maria Chiara Buscarinu, Gianmarco Bellucci, Silvia Romano, Daniela Scarabino, Marco Salvetti, Giovanni Ristori
Author Information
  1. Emanuele Morena: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy. ORCID
  2. Carmela Romano: Department of Human Neurosciences, Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy.
  3. Martina Marconi: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy.
  4. Selene Diamant: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy.
  5. Maria Chiara Buscarinu: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy. ORCID
  6. Gianmarco Bellucci: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy. ORCID
  7. Silvia Romano: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy. ORCID
  8. Daniela Scarabino: Institute of Molecular Biology and Pathology, National Research Council, 00185 Rome, Italy. ORCID
  9. Marco Salvetti: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy. ORCID
  10. Giovanni Ristori: Department of Neurosciences, Mental Health and Sensory Organs (NESMOS), Sant'Andrea Hospital, Sapienza University of Rome, 00189 Rome, Italy.

Abstract

Huntington's disease (HD) is characterized by clinical motor impairment (e.g., involuntary movements, poor coordination, parkinsonism), cognitive deficits, and psychiatric symptoms. An inhered expansion of the CAG triplet in the huntingtin gene causing a pathogenic gain-of-function of the mutant huntingtin () protein has been identified. In this review, we focus on known biomarkers (e.g., mHTT, neurofilament light chains) and on new biofluid biomarkers that can be quantified in plasma or peripheral blood mononuclear cells from mHTT carriers. Circulating biomarkers may fill current unmet needs in HD management: better stratification of patients amenable to etiologic treatment; the initiation of preventive treatment in premanifest HD; and the identification of peripheral pathogenic central nervous system cascades.

Keywords

References

  1. Front Neurol. 2020 Nov 19;11:580732 [PMID: 33329322]
  2. N Engl J Med. 2019 Jun 13;380(24):2307-2316 [PMID: 31059641]
  3. Mov Disord Clin Pract. 2019 Aug 16;6(7):586-592 [PMID: 31538093]
  4. Methods Mol Biol. 2018;1780:329-396 [PMID: 29856027]
  5. Cell. 2007 Sep 21;130(6):991-1004 [PMID: 17889645]
  6. J Clin Invest. 2012 Oct;122(10):3731-6 [PMID: 22996692]
  7. Parkinsonism Relat Disord. 2021 Apr;85:91-94 [PMID: 33770670]
  8. Cell Metab. 2019 Oct 1;30(4):656-673 [PMID: 31447320]
  9. Nature. 1983 Nov 17-23;306(5940):234-8 [PMID: 6316146]
  10. Expert Rev Neurother. 2019 Oct;19(10):983-995 [PMID: 31181964]
  11. J Neurosci. 2008 Dec 31;28(53):14341-6 [PMID: 19118166]
  12. Ann Clin Lab Sci. 2016 May;46(3):260-5 [PMID: 27312549]
  13. Eur J Neurol. 2010 Aug;17(8):1068-74 [PMID: 20192977]
  14. J Huntingtons Dis. 2020;9(2):185-197 [PMID: 32250312]
  15. Neurobiol Dis. 2008 Mar;29(3):438-45 [PMID: 18082412]
  16. Genes (Basel). 2016 Sep 03;7(9): [PMID: 27598205]
  17. Neuron. 1995 Sep;15(3):493-6 [PMID: 7546729]
  18. J Exp Neurosci. 2018 May 1;12:1179069518772380 [PMID: 29760562]
  19. Parkinsonism Relat Disord. 2022 Apr;97:25-28 [PMID: 35276585]
  20. Nat Rev Neurol. 2016 Jan;12(1):15-27 [PMID: 26635213]
  21. Nat Med. 2014 Aug;20(8):881-5 [PMID: 25038828]
  22. Lancet Neurol. 2011 Jun;10(6):573-90 [PMID: 21601164]
  23. Nat Rev Cancer. 2004 Sep;4(9):727-37 [PMID: 15343279]
  24. J Huntingtons Dis. 2018;7(2):109-135 [PMID: 29614689]
  25. Int J Mol Sci. 2021 Feb 04;22(4): [PMID: 33557131]
  26. Front Mol Neurosci. 2019 Oct 25;12:258 [PMID: 31708741]
  27. Neurology. 2013 Sep 24;81(13):1134-40 [PMID: 23966247]
  28. Int J Mol Sci. 2022 May 17;23(10): [PMID: 35628406]
  29. Genes (Basel). 2016 Sep 01;7(9): [PMID: 27598203]
  30. Neurology. 2018 Feb 20;90(8):e717-e723 [PMID: 29367444]
  31. Anal Biochem. 2009 Dec 1;395(1):8-15 [PMID: 19664996]
  32. Neuromolecular Med. 2012 Dec;14(4):221-43 [PMID: 22581158]
  33. Alzheimers Dement (N Y). 2018 Sep 06;4:575-590 [PMID: 30406177]
  34. Prog Neurobiol. 2019 Nov;182:101664 [PMID: 31356849]
  35. Mov Disord. 2015 Dec;30(14):1961-4 [PMID: 26573701]
  36. Lancet Neurol. 2013 Jul;12(7):637-49 [PMID: 23664844]
  37. Parkinsonism Relat Disord. 2021 Jun;87:32-38 [PMID: 33940564]
  38. Int J Mol Sci. 2019 Nov 30;20(23): [PMID: 31801298]
  39. Genes Dev. 2011 Mar 1;25(5):409-33 [PMID: 21363960]
  40. Mol Cell Neurosci. 2019 Jun;97:67-80 [PMID: 30807825]
  41. Trends Cell Biol. 2009 May;19(5):207-17 [PMID: 19342239]
  42. Parkinsonism Relat Disord. 2016 Apr;25:58-64 [PMID: 26898966]
  43. Nat Rev Mol Cell Biol. 2009 Apr;10(4):243-54 [PMID: 19277046]
  44. Nat Rev Neurol. 2018 Nov;14(11):639-652 [PMID: 30297701]
  45. Mov Disord. 1996 Mar;11(2):136-42 [PMID: 8684382]
  46. Trends Biochem Sci. 2002 Jul;27(7):339-44 [PMID: 12114022]
  47. Ann Neurol. 1978 Jun;3(6):545-8 [PMID: 150253]
  48. Nat Rev Mol Cell Biol. 2018 Apr;19(4):213-228 [PMID: 29339798]
  49. Lancet Neurol. 2011 Jan;10(1):83-98 [PMID: 21163446]
  50. J Clin Invest. 2015 May;125(5):1979-86 [PMID: 25844897]
  51. Neurochem Int. 2021 Mar;144:104955 [PMID: 33412233]
  52. Mech Ageing Dev. 2020 Jan;185:111189 [PMID: 31759995]
  53. Int J Mol Sci. 2016 Feb 06;17(2):170 [PMID: 26861301]
  54. Mov Disord. 2022 Jul;37(7):1526-1531 [PMID: 35437792]
  55. Parkinsonism Relat Disord. 2009 Mar;15(3):245-8 [PMID: 19056308]
  56. J Neurol Sci. 2019 Jan 15;396:25-29 [PMID: 30396032]
  57. Nat Cell Biol. 2007 Jun;9(6):654-9 [PMID: 17486113]
  58. Hum Mol Genet. 2011 Jun 1;20(11):2225-37 [PMID: 21421997]
  59. Nat Rev Neurol. 2018 Oct;14(10):577-589 [PMID: 30171200]
  60. Sci Transl Med. 2018 Sep 12;10(458): [PMID: 30209243]
  61. Neuropathol Appl Neurobiol. 2017 Apr;43(3):194-199 [PMID: 28054371]
  62. BMC Bioinformatics. 2013;14 Suppl 14:S2 [PMID: 24267974]
  63. J Neurochem. 2016 Oct;139(1):22-5 [PMID: 27344050]
  64. J Extracell Vesicles. 2015 May 14;4:27066 [PMID: 25979354]
  65. BMC Med Genomics. 2015 Mar 01;8:10 [PMID: 25889241]
  66. Int J Mol Sci. 2020 Dec 25;22(1): [PMID: 33375558]
  67. J Neuroimmunol. 2020 Apr 15;341:577187 [PMID: 32050150]
  68. Science. 2015 Dec 4;350(6265):1193-8 [PMID: 26785477]
  69. J Extracell Vesicles. 2018 Nov 23;7(1):1535750 [PMID: 30637094]
  70. Int J Mol Sci. 2022 Nov 03;23(21): [PMID: 36362235]
  71. Exp Gerontol. 2017 Nov;98:143-147 [PMID: 28827085]
  72. Ann Neurol. 2019 Feb;85(2):296-301 [PMID: 30549309]
  73. Front Neurosci. 2017 Feb 27;11:82 [PMID: 28289371]
  74. Cell. 1993 Mar 26;72(6):971-83 [PMID: 8458085]
  75. Brain Sci. 2020 Mar 07;10(3): [PMID: 32156063]
  76. Orphanet J Rare Dis. 2017 Dec 19;12(1):185 [PMID: 29258536]
  77. Neurology. 2018 Jan 23;90(4):e264-e272 [PMID: 29282329]
  78. Gait Posture. 2018 May;62:451-457 [PMID: 29660633]
  79. Front Neurol. 2021 May 05;12:657973 [PMID: 34025560]
  80. Annu Rev Cell Dev Biol. 2014;30:255-89 [PMID: 25288114]
  81. Nat Rev Neurol. 2014 Apr;10(4):204-16 [PMID: 24614516]
  82. Cell. 2004 Jan 23;116(2):281-97 [PMID: 14744438]
  83. Mov Disord. 2017 Feb;32(2):256-263 [PMID: 27892614]
  84. Annu Rev Clin Psychol. 2018 May 7;14:371-397 [PMID: 29494257]
  85. PLoS One. 2017 Feb 27;12(2):e0172762 [PMID: 28241046]
  86. Front Oncol. 2019 Jul 09;9:587 [PMID: 31338327]
  87. Sci Transl Med. 2020 Dec 16;12(574): [PMID: 33328328]
  88. J Biol Chem. 1998 Mar 6;273(10):5858-68 [PMID: 9488723]
  89. Int J Mol Sci. 2022 Oct 18;23(20): [PMID: 36293304]
  90. Lancet Diabetes Endocrinol. 2021 Feb;9(2):117-126 [PMID: 33248477]
  91. J Biomed Sci. 2020 Apr 7;27(1):49 [PMID: 32264890]
  92. PLoS Genet. 2014 Feb 27;10(2):e1004188 [PMID: 24586208]
  93. Pract Neurol. 2015 Feb;15(1):80-4 [PMID: 25169240]
  94. J Neuropsychiatry Clin Neurosci. 2015;27(2):e92-6 [PMID: 25541866]

MeSH Term

Humans
Huntington Disease
Leukocytes, Mononuclear
Cognition Disorders
Biomarkers
Cognitive Dysfunction
Huntingtin Protein

Chemicals

Biomarkers
Huntingtin Protein

Word Cloud

Created with Highcharts 10.0.0HDbiomarkersmHTTperipheralHuntington'sdiseaseeghuntingtingenepathogenicneurofilamentlightplasmabloodtreatmentpremanifestbiomarkercharacterizedclinicalmotorimpairmentinvoluntarymovementspoorcoordinationparkinsonismcognitivedeficitspsychiatricsymptomsinheredexpansionCAGtripletcausinggain-of-functionmutantproteinidentifiedreviewfocusknownchainsnewbiofluidcanquantifiedmononuclearcellscarriersCirculatingmayfillcurrentunmetneedsmanagement:betterstratificationpatientsamenableetiologicinitiationpreventiveidentificationcentralnervoussystemcascadesPeripheralBiomarkersManifestPremanifestDiseaseDNAdamageresponseHuntington’stherapyleukocytetelomerelengthmanifestchain

Similar Articles

Cited By