OpenLB
Open Library of Bioscience
Advanced Search
Archives of sexual behavior
Jul, 2024;53 (7): 2653-2670.

Learning About Sex from Different Sources: Implications for Sexual Attitudes, Sexual Knowledge, and Risky Sexual Behavior Among U.S. College Students.

Aya Shigeto, Lawrence M Scheier
Author Information
  1. Aya Shigeto: Department of Psychology and Neuroscience, Nova Southeastern University, 3301 College Avenue, Fort Lauderdale, FL, 33314, USA. as1959@nova.edu. ORCID
  2. Lawrence M Scheier: LARS Research Institute, Inc, Sun City, AZ, USA. ORCID
PMID: 38877330 DOI: 10.1007/s10508-024-02901-w

Abstract

This exploratory cross-sectional study, guided by primary socialization theory, examined relations between four primary socialization agents of sexual learning (i.e., mothers, fathers, friends/peers, and online media) and sexual attitudes, sexual knowledge, and risky sexual behavior. Latent-variable structural equation models were tested using self-report data obtained from 515 emerging adults who had spent at least 6 months attending in-person college classes. Results showed that learning about sex from mothers was associated with more conservative sexual attitudes and lower risky sexual behavior. Sexual learning from friends/peers was linked to liberal sexual attitudes and greater sexual knowledge. Learning from online media was associated with increased sexual knowledge. To account for a shift in sexual learning patterns from before to after entry to college, we created algebraic difference scores for each source of sexual information. Greater reliance on sexual learning from friends/peers in the past 6 months of college relative to before college was associated with liberal sexual attitudes and greater sexual knowledge. Additional analyses revealed different effects of learning about sex from mothers more during college than before college between those living on campus vs. commuters living at home. The discussion emphasizes the different role that each of the primary socialization agents plays for emerging adults' sexual development, including the protective role of mothers against risky sexual behavior, the impact of friends and peers on sexual attitudes and knowledge, and the shifting dynamics of socialization processes during college.

Keywords

Emerging adulthood Primary socialization theory Risky sexual behavior Sexual attitudes Sexual knowledge Sexual learning

References

  1. Ajzen, I. (1991). The theory of planned behavior. Organizational Behavior and Human Decision Processes, 50(2), 179���211. https://doi.org/10.1016/0749-5978(91)90020-T [DOI: 10.1016/0749-5978(91)90020-T]
  2. Allen, L. (2001). Closing sex education���s knowledge/practice gap: The reconceptualisation of young people���s sexual knowledge. Sex Education, 1(2), 109���122. https://doi.org/10.1080/14681810120052542 [DOI: 10.1080/14681810120052542]
  3. Anders, K. M., Goodcase, E., Yazedjian, A., & Toews, M. L. (2020). ���Sex is easier to get and love is harder to find���: Costs and rewards of hooking up among first-year college students. Journal of Sex Research, 57(2), 247���259. https://doi.org/10.1080/00224499.2019.1667946 [DOI: 10.1080/00224499.2019.1667946]
  4. Arnett, J. J. (2000). Emerging adulthood: A theory of development from the late teens through the twenties. American Psychologist, 55(5), 469���480. https://doi.org/10.1037/0003-066X.55.5.469 [DOI: 10.1037/0003-066X.55.5.469]
  5. Arnett, J. J. (2015). Emerging adulthood: The winding road from the late teens through the twenties (2nd ed.). Oxford: Oxford University Press. https://doi.org/10.1093/oxfordhb/9780199795574.013.9 [DOI: 10.1093/oxfordhb/9780199795574.013.9]
  6. Asparouhov, T., & Muth��n, B. (2009). Exploratory structural equation modeling. Structural Equation Modeling: A Multidisciplinary Journal, 16(3), 397���438. https://doi.org/10.1080/10705510903008204 [DOI: 10.1080/10705510903008204]
  7. Astle, S., McAllister, P., Emanuels, S., Rogers, J., Toews, M., & Yazedjian, A. (2022). Just be open about it or turn up the radio: A qualitative analysis of parent-child sexual communication experiences in adolescence. Sexuality Research and Social Policy, 19(1), 133���146. https://doi.org/10.1007/s13178-020-00530-1 [DOI: 10.1007/s13178-020-00530-1]
  8. Astle, S. M., Anders, K. M., Shigeto, A., & Rajesh, P. (2023a). ���Keep talking to me���: College-attending women���s desires for support from mothers, fathers, and friends/peers in healthy sexual decision-making. Archives of Sexual Behavior, 52, 1593���1606. https://doi.org/10.1007/s10508-023-02538-1 [DOI: 10.1007/s10508-023-02538-1]
  9. Astle, S., Anders, K., Shigeto, A., & Rodriguez, K. (2023b). College women���s memorable sexual messages from mothers, fathers, friends/peers, and online media: A mixed-methods latent class analysis. Emerging Adulthood, 11(1), 133���147. https://doi.org/10.1177/21676968221098453 [DOI: 10.1177/21676968221098453]
  10. Bandalos, D. L. (2002). The effects of item parceling on goodness-of-fit and parameter estimate bias in structural equation modeling. Structural Equation Modeling: A Multidisciplinary Journal, 9(1), 78���102. https://doi.org/10.1207/S15328007SEM0901_5 [DOI: 10.1207/S15328007SEM0901_5]
  11. Bandura, A. (1986). Social foundations of thought and action: A social cognitive theory. Hoboken: Prentice-Hall.
  12. Bangpan, M., & Operario, D. (2012). Understanding the role of family on sexual-risk decisions of young women: A systematic review. AIDS Care, 24(9), 1163���1172. https://doi.org/10.1080/09540121.2012.699667 [DOI: 10.1080/09540121.2012.699667]
  13. Basile, K. C., Smith, S. G., Kresnow, M., Khatiwada, S., & Leemis, R. W. (2022). The National Intimate Partner and Sexual Violence Survey: 2016/2017 Report on Sexual Violence. National Center for Injury Prevention and Control, Centers for Disease Control and Prevention. https://www.cdc.gov/violenceprevention/pdf/nisvs/nisvsReportonSexualViolence.pdf
  14. Becker, M. H. (1974). The health belief model and personal health behavior. Health Education Monographs, 2, 324���508. [DOI: 10.1177/109019817400200407]
  15. Bentler, P. M. (1990). Comparative fit indexes in structural models. Psychological Bulletin, 107(2), 238���246. https://doi.org/10.1037/0033-2909.107.2.238 [DOI: 10.1037/0033-2909.107.2.238]
  16. Bhuptani, P. H., Kenney, S. R., Napper, L. E., & Orchowski, L. M. (2023). Pornography use, perceived peer norms, and attitudes toward women: A study of college men. American Journal of Sexuality Education. https://doi.org/10.1080/15546128.2023.2233414 [DOI: 10.1080/15546128.2023.2233414]
  17. Bleakley, A., Hennessy, M., Fishbein, M., & Jordan, A. (2009). How sources of sexual information relate to adolescents��� beliefs about sex. American Journal of Health Behavior, 33(1), 37���48. https://doi.org/10.5993/ajhb.33.1.4 [DOI: 10.5993/ajhb.33.1.4]
  18. Bleakley, A., Khurana, A., Hennessy, M., & Ellithorpe, M. (2018). How patterns of learning about sexual information among adolescents are related to sexual behaviors. Perspectives on Sexual and Reproductive Health, 50(1), 15���23. https://doi.org/10.1363/psrh.12053 [DOI: 10.1363/psrh.12053]
  19. Boone, T. L. (2015). Messages about sexuality: An ecological perspective. Sex Education, 15(4), 437���450. https://doi.org/10.1080/14681811.2015.1036981 [DOI: 10.1080/14681811.2015.1036981]
  20. Buhi, E. R., Daley, E. M., Fuhrmann, H. J., & Smith, S. A. (2009). An observational study of how young people search for online sexual health information. Journal of American College Health, 58(2), 101���111. https://doi.org/10.1080/07448480903221236 [DOI: 10.1080/07448480903221236]
  21. Byers, E. S., Sears, H. A., & Hughes, K. (2018). Predicting mother-adolescent sexual communication using the integrative model of behavioral prediction. Journal of Family Issues, 39(5), 1213���1235. https://doi.org/10.1177/0192513X17698183 [DOI: 10.1177/0192513X17698183]
  22. Centers for Disease Control and Prevention. (2021). Sexually transmitted infections prevalence, incidence, and cost estimates in the United States. https://www.cdc.gov/std/statistics/prevalence-2020-at-a-glance.htm
  23. Coffman, D. L., & MacCallum, R. C. (2005). Using parcels to convert path analysis models into latent variable models. Multivariate Behavioral Research, 40(2), 235���259. https://doi.org/10.1207/s15327906mbr4002_4 [DOI: 10.1207/s15327906mbr4002_4]
  24. Cook, E. C. (2020). Understanding the associations between helicopter parenting and emerging adults��� adjustment. Journal of Child and Family Studies, 29, 1899���1913. https://doi.org/10.1007/s10826-020-01716-2 [DOI: 10.1007/s10826-020-01716-2]
  25. Cooper, M. L. (2002). Alcohol use and risky sexual behavior among college students and youth: Evaluating the evidence. Journal of Studies on Alcohol(suppl.), 14, 101���117. https://doi.org/10.15288/jsas.2002.s14.101 [DOI: 10.15288/jsas.2002.s14.101]
  26. Coyne, S. M., Ward, L. M., Kroff, S. L., Davis, E. J., Holmgren, H. G., Jensen, A. C., Erickson, S. E., & Essig, L. W. (2019). Contributions of mainstream sexual media exposure to sexual attitudes, perceived peer norms, and sexual behavior: A meta-analysis. Journal of Adolescent Health, 64(4), 430���436. https://doi.org/10.1016/j.jadohealth.2018.11.016 [DOI: 10.1016/j.jadohealth.2018.11.016]
  27. Cronbach, L. J., & Furby, L. (1970). How we should measure ���change���: Or should we? Psychological Bulletin, 74(1), 68���80. https://doi.org/10.1037/h0029382 [DOI: 10.1037/h0029382]
  28. Diez, S. L., Fava, N. M., Fernandez, S. B., & Mendel, W. E. (2022). Sexual health education: The untapped and unmeasured potential of US-based websites. Sex Education, 22(3), 335���347. https://doi.org/10.1080/14681811.2021.1935227 [DOI: 10.1080/14681811.2021.1935227]
  29. Dilorio, C., Kelley, M., & Hockenberry-Eaton, M. (1999). Communication about sexual issues: Mothers, fathers, and friends. Journal of Adolescent Health, 24(3), 181���189. https://doi.org/10.1016/S1054-139X(98)00115-3 [DOI: 10.1016/S1054-139X(98)00115-3]
  30. Dilorio, C., Parsons, M., Lehr, S., Adame, D., & Carlone, J. (1992). Measurement of safe sex behavior in adolescents and young adults. Nursing Research, 41(4), 203���208.
  31. Endendijk, J. J., Dekovi��, M., Vossen, H., van Baar, A. L., & Reitz, E. (2022). Sexual double standards: Contributions of sexual socialization by parents, peers, and the media. Archives of Sexual Behavior, 51, 1721���17401. https://doi.org/10.1007/s10508-021-02088-4 [DOI: 10.1007/s10508-021-02088-4]
  32. Epstein, M., & Ward, L. M. (2008). ���Always use protection���: Communication boys receive about sex from parents, peers, and the media. Journal of Youth and Adolescence, 37(2), 113���126. https://doi.org/10.1007/s10964-007-9187-1 [DOI: 10.1007/s10964-007-9187-1]
  33. Fehr, S. K., Vidourek, R. A., & King, K. A. (2015). Intra-and inter-personal barriers to condom use among college students: A review of the literature. Sexuality & Culture, 19, 103���121. https://doi.org/10.1007/s12119-014-9249-y [DOI: 10.1007/s12119-014-9249-y]
  34. Fisher, T. D. (2011). Weighted topics measures of family sexual communication. In T. D. Fisher, C. M. Davis, W. L. Yarber, & S. L. Davis (Eds.), Handbook of sexuality-related measures (3rd ed., pp. 132���134). Taylor & Francis.
  35. Fisher, T. D., & Hall, R. G. (1988). A scale for the comparison of the sexual attitudes of adolescents and their parents. Journal of Sex Research, 24(1), 90���100. https://doi.org/10.1080/00224498809551400 [DOI: 10.1080/00224498809551400]
  36. Francis, S. A., & Thorpe, R. J. (2010). Using the primary socialization theory to predict substance use and sexual risk behaviors between black and white adolescents. Substance Use & Misuse, 45(13), 2113���2129. https://doi.org/10.3109/10826081003682248 [DOI: 10.3109/10826081003682248]
  37. Franklin, R. M., & Dotger, S. (2011). Sex education knowledge differences between freshmen and senior college undergraduates. College Student Journal, 45(1), 199���213.
  38. Fraser, S., Moore, D., Waling, A., & Farrugia, A. (2021). Making epistemic citizens: Young people and the search for reliable and credible sexual health information. Social Science & Medicine, 276. https://doi.org/10.1016/j.socscimed.2021.113817
  39. Friedman, C. K., & Morgan, E. M. (2009). Comparing sexual-minority and heterosexual young women���s friends and parents as sources of support for sexual issues. Journal of Youth and Adolescence, 38(7), 920���936. https://doi.org/10.1007/s10964-008-9361-0 [DOI: 10.1007/s10964-008-9361-0]
  40. Fromme, K., Corbin, W. R., & Kruse, M. I. (2008). Behavioral risks during the transition from high school to college. Developmental Psychology, 44(5), 1497���1504. https://doi.org/10.1037/a0012614 [DOI: 10.1037/a0012614]
  41. Fullard, W., & Scheier, L. (2011). The Sexual Knowledge and Attitude Test for Adolescents. In T. D. Fisher, C. M. Davis, W. L. Yarber, & S. L. Davis (Eds.), Handbook of sexuality-related measures (3rd ed., pp. 16���18). Taylor & Francis.
  42. Goldfarb, E. S., & Lieberman, L. D. (2021). Three decades of research: The case for comprehensive sex education. Journal of Adolescent Health, 68(1), 13���27. https://doi.org/10.1016/j.jadohealth.2020.07.036 [DOI: 10.1016/j.jadohealth.2020.07.036]
  43. Guse, K., Levine, D., Martins, S., Lira, A., Gaarde, J., Westmorland, W., & Gilliam, M. (2012). Interventions using new digital media to improve adolescent sexual health: A systematic review. Journal of Adolescent Health, 51(6), 535���543. https://doi.org/10.1016/j.jadohealth.2012.03.014 [DOI: 10.1016/j.jadohealth.2012.03.014]
  44. Guttmacher Institute. (2023). Sex and HIV education. https://www.guttmacher.org/state-policy/explore/sex-and-hiv-education
  45. Halpern, C. T., & Kaestle, C. E. (2014). Sexuality in emerging adulthood. Person-based approachesIn D. L. Tolman, L. M. Diamond, J. A. Bauermeister, W. H. George, J. G. Pfaus, & L. M. Ward (Eds.), APA handbook of sexuality and psychology (Vol. 1, pp. 487���522). American Psychological Association.
  46. Hambelton, R. K., Swaminathan, H., & Rogers, J. H. (1991). Fundamentals of item response theory. Sage Publications.
  47. Higgins, G. E., Ricketts, M. L., Marcum, C. D., & Mahoney, M. (2010). Primary socialization theory: An exploratory study of delinquent trajectories. Criminal Justice Studies, 23(2), 133���146. https://doi.org/10.1080/1478601X.2010.485472 [DOI: 10.1080/1478601X.2010.485472]
  48. Hong, P., & Cui, M. (2020). Helicopter parenting and college students��� psychological maladjustment: The role of self-control and living arrangement. Journal of Child and Family Studies, 29, 338���347. https://doi.org/10.1007/s10826-019-01541-2 [DOI: 10.1007/s10826-019-01541-2]
  49. Hu, L., & Bentler, P. M. (1999). Cutoff criteria for fit indexes in covariance structure analysis: Conventional criteria versus new alternatives. Structural Equation Modeling: A Multidisciplinary Journal, 6(1), 1���55. https://doi.org/10.1080/10705519909540118 [DOI: 10.1080/10705519909540118]
  50. Hutchinson, M. K., & Cederbaum, J. A. (2011). Talking to daddy���s little girl about sex: Daughters��� reports of sexual communication and support from fathers. Journal of Family Issues, 32(4), 550���572. https://doi.org/10.1177/0192513X10384222 [DOI: 10.1177/0192513X10384222]
  51. Institute of Education Sciences, National Center for Education Statistics. (2023). College enrollment rates. https://nces.ed.gov/programs/coe/indicator/cpb
  52. Kishton, J. M., & Widaman, K. F. (1994). Unidimensional verses domain representative parceling of questionnaire items: An empirical example. Educational and Psychological Measurement, 54(3), 757���765. https://doi.org/10.1177/0013164494054003022 [DOI: 10.1177/0013164494054003022]
  53. Kwon, K. A., Yoo, G., & De Gagne, J. C. (2017). Does culture matter? A qualitative inquiry of helicopter parenting in Korean American college students. Journal of Child and Family Studies, 26, 1979���1990. https://doi.org/10.1007/s10826-017-0694-8 [DOI: 10.1007/s10826-017-0694-8]
  54. Lefkowitz, E. S., & Espinosa-Hernandez, G. (2007). Sex-related communication with mothers and close friends during the transition to university. Journal of Sex Research, 44(1), 17���27. https://doi.org/10.1080/00224490709336789 [DOI: 10.1080/00224490709336789]
  55. Lefkowitz, E. S., Boone, T. L., & Shearer, C. L. (2004). Communication with best friends about sex-related topics during emerging adulthood. Journal of Youth and Adolescence, 33(4), 339���351. https://doi.org/10.1023/B:JOYO.0000032642.27242.c1 [DOI: 10.1023/B]
  56. Lim, M. S., Vella, A., Sacks-Davis, R., & Hellard, M. E. (2014). Young people���s comfort receiving sexual health information via social media and other sources. International Journal of STD & AIDS, 25(14), 1003���1008. https://doi.org/10.1177/0956462414527264 [DOI: 10.1177/0956462414527264]
  57. Lin, W. H., Liu, C. H., & Yi, C. C. (2020). Exposure to sexually explicit media in early adolescence is related to risky sexual behavior in emerging adulthood. PLoS ONE, 15(4), e0230242. https://doi.org/10.1371/journal.pone.0230242 [DOI: 10.1371/journal.pone.0230242]
  58. Lindberg, L. D., Maddow-Zimet, I., & Boonstra, H. (2016). Changes in adolescents��� receipt of sex education, 2006���2013. Journal of Adolescent Health, 58(6), 621���627. https://doi.org/10.1016/j.jadohealth.2016.02.004 [DOI: 10.1016/j.jadohealth.2016.02.004]
  59. Little, T. D., Rhemtulla, M., Gibson, K., & Schoemann, A. M. (2013). Why the items versus parcels controversy needn���t be one. Psychological Methods, 18(3), 285���300. https://doi.org/10.1037/a0033266 [DOI: 10.1037/a0033266]
  60. Little, T. D., Cunningham, W. A., Shahar, G., & Widaman, K. F. (2002). To parcel or not to parcel: Exploring the question, weighing the merits. Structural Equation Modeling, 9(2), 151���173. https://doi.org/10.1207/S15328007SEM0902_1 [DOI: 10.1207/S15328007SEM0902_1]
  61. Luebbe, A. M., Mancini, K. J., Kiel, E. J., Spangler, B. R., Semlak, J. L., & Fussner, L. M. (2018). Dimensionality of helicopter parenting and relations to emotional, decision-making, and academic functioning in emerging adults. Assessment, 25(7), 841���857. https://doi.org/10.1177/1073191116665907 [DOI: 10.1177/1073191116665907]
  62. Marsh, H. W., L��dtke, O., Nagengast, B., Morin, A. J. S., & von Davier, M. (2013). Why item parcels are (almost) never appropriate: Two wrongs do not make a right���Camouflaging misspecification with item parcels in CFA models. Psychological Methods, 18(3), 257���284. https://doi.org/10.1037/a0032773 [DOI: 10.1037/a0032773]
  63. Marsh, H. W., Muth��n, B., Asparouhov, T., Ludtke, O., Robitzsch, A., Morin, A. J. S., & Trautwein, U. (2009). Exploratory structural equation modeling, integrating CFA and EFA: Application to students��� evaluations of university teaching. Structural Equation Modeling: A Multidisciplinary Journal, 16(3), 439���476. https://doi.org/10.1080/10705510903008220 [DOI: 10.1080/10705510903008220]
  64. Morgan, E. M. (2011). Associations between young adults��� use of sexually explicit materials and their sexual preferences, behaviors, and satisfaction. Journal of Sex Research, 48(6), 520���530. https://doi.org/10.1080/00224499.2010.543960 [DOI: 10.1080/00224499.2010.543960]
  65. Morgan, E. M., & Zurbriggen, E. L. (2012). Changes in sexual values and their sources over the 1st year of college. Journal of Adolescent Research, 27(4), 471���497. https://doi.org/10.1177/0743558411432637 [DOI: 10.1177/0743558411432637]
  66. Morgan, E. M., Thorne, A., & Zurbriggen, E. L. (2010). A longitudinal study of conversations with parents about sex and dating during college. Developmental Psychology, 46(1), 139���150. https://doi.org/10.1037/a0016931 [DOI: 10.1037/a0016931]
  67. Moussa Rogers, M., & McKinney, C. (2019). Emerging adult risky sexual behavior predicted by parental overprotection: Moderated mediation analysis. Family Process, 58(4), 972���985. https://doi.org/10.1111/famp.12394 [DOI: 10.1111/famp.12394]
  68. Muth��n, L. K., & Muth��n, B. O. (2008���2017). Mplus user���s guide (Eighth ed.). Author.
  69. Nadelson, L. S., Semmelroth, C., Martinez, G., Featherstone, M., Fuhriman, C. A., & Sell, A. (2013). Why did they come here? ��� The influences and expectations of first-year students��� college experience. Higher Education Studies, 3(1), 50���62. https://doi.org/10.5539/hes.v3n1p50 [DOI: 10.5539/hes.v3n1p50]
  70. Nikkelen, S. W., van Oosten, J. M., & van den Borne, M. M. (2019). Sexuality education in the digital era: Intrinsic and extrinsic predictors of online sexual information seeking among youth. Journal of Sex Research, 57(2), 189���199. https://doi.org/10.1080/00224499.2019.1612830 [DOI: 10.1080/00224499.2019.1612830]
  71. Nurgitz, R., Pacheco, R. A., Senn, C. Y., & Hobden, K. L. (2021). The impact of sexual education and socialization on sexual satisfaction, attitudes, and self-efficacy. Canadian Journal of Human Sexuality, 30(2), 265���277. https://doi.org/10.3138/cjhs.2021-0028 [DOI: 10.3138/cjhs.2021-0028]
  72. Oetting, E. R., & Beauvais, F. (1987). Peer cluster theory, socialization characteristics and adolescent drug use: A path analysis. Journal of Counseling Psychology, 34(2), 205���213. https://doi.org/10.1037/0022-0167.34.2.205 [DOI: 10.1037/0022-0167.34.2.205]
  73. Oetting, E. R., & Donnermeyer, J. F. (1998). Primary socialization theory: The etiology of drug use and deviance. I. Substance Use & Misuse, 33(4), 995���1026. https://doi.org/10.3109/10826089809056252 [DOI: 10.3109/10826089809056252]
  74. Okazaki, S. (2002). Influences of culture on Asian Americans��� sexuality. Journal of Sex Research, 39(1), 34���41. https://doi.org/10.1080/00224490209552117 [DOI: 10.1080/00224490209552117]
  75. Orchowski, L. M., & Barnett, N. P. (2012). Alcohol-related sexual consequences during the transition from high school to college. Addictive Behaviors, 37(3), 256���263. https://doi.org/10.1016/j.addbeh.2011.10.010 [DOI: 10.1016/j.addbeh.2011.10.010]
  76. Owen, J. J., Rhoades, G. K., Stanley, S. M., & Fincham, F. D. (2010). ���Hooking up��� among college students: Demographic and psychosocial correlates. Archives of Sexual Behavior, 39, 653���663. https://doi.org/10.1007/s10508-008-9414-1 [DOI: 10.1007/s10508-008-9414-1]
  77. Padilla-Walker, L. M., & Nelson, L. J. (2012). Black hawk down?: Establishing helicopter parenting as a distinct construct from other forms of parental control during emerging adulthood. Journal of Adolescence, 35(5), 1177���1190. https://doi.org/10.1016/j.adolescence.2012.03.007 [DOI: 10.1016/j.adolescence.2012.03.007]
  78. Pariera, K. L., & Abraham, B. (2020). ���We talked about our hookups���: A diary study of sexual communication among US college women. Journal of Social and Personal Relationships, 37(8���9), 2620���2633. https://doi.org/10.1177/0265407520933002 [DOI: 10.1177/0265407520933002]
  79. Pettigrew, J., Shin, Y., Stein, J. B., & Van Raalte, L. J. (2017). Family communication and adolescent alcohol use in Nicaragua, Central America: A test of primary socialization theory. Journal of Family Communication, 17(1), 33���48. https://doi.org/10.1080/15267431.2016.1251921 [DOI: 10.1080/15267431.2016.1251921]
  80. Randolph, M. E., Torres, H., Gore-Felton, C., Lloyd, B., & McGarvey, E. L. (2009). Alcohol use and sexual risk behavior among college students: Understanding gender and ethnic differences. American Journal of Drug and Alcohol Abuse, 35(2), 80���84. https://doi.org/10.1080/00952990802585422 [DOI: 10.1080/00952990802585422]
  81. Reed, K., Duncan, J. M., Lucier-Greer, M., Fixelle, C., & Ferraro, A. J. (2016). Helicopter parenting and emerging adult self-efficacy: Implications for mental and physical health. Journal of Child and Family Studies, 25, 3136���3149. https://doi.org/10.1007/s10826-016-0466-x [DOI: 10.1007/s10826-016-0466-x]
  82. Rew, L., Arheaert, K. L., Thomposon, S., & Johnson, K. (2013). Predictors of adolescents��� health-promoting behaviors guided by primary socialization theory. Journal for Specialists in Pediatric Nursing, 18(4), 277���288. https://doi.org/10.1111/jspn.12036 [DOI: 10.1111/jspn.12036]
  83. Sales, J. M., Milhausen, R. R., Wingood, G. M., DiClemente, R. J., Salazar, L. F., & Crosby, R. A. (2008). Validation of a Parent-Adolescent Communication Scale for use in STD/HIV prevention interventions. Health Education & Behavior, 35(3), 332���345. https://doi.org/10.1177/1090198106293524 [DOI: 10.1177/1090198106293524]
  84. Schiffrin, H. H., Liss, M., Miles-McLean, H., Geary, K. A., Erchull, M. J., & Tashner, T. (2014). Helping or hovering? The effects of helicopter parenting on college students��� well-being. Journal of Child and Family Studies, 23, 548���557. https://doi.org/10.1007/s10826-013-9716-3 [DOI: 10.1007/s10826-013-9716-3]
  85. Simon, L., & Daneback, K. (2013). Adolescents��� use of the internet for sex education: A thematic and critical review of the literature. International Journal of Sexual Health, 25(4), 305���319. https://doi.org/10.1080/19317611.2013.823899 [DOI: 10.1080/19317611.2013.823899]
  86. Sinnenberg, L., Buttenheim, A. M., Padrez, K., Mancheno, C., Ungar, L., & Merchant, R. M. (2017). Twitter as a tool for health research: A systematic review. American Journal of Public Health, 107(1), e1���e8. https://doi.org/10.2105/AJPH.2016.303512 [DOI: 10.2105/AJPH.2016.303512]
  87. Smith, A., Rainie, L., & Zickuhr, K. (2011). College students and technology. Pew Research Center.
  88. Steiger, J. H., & Lind, J. C. (1980, May 30). Statistically-based tests for the number of common factors [Paper presentation]. The annual Spring Meeting of the Psychometric Society, Iowa City, IA.
  89. Stevens, R., Gilliard-Matthews, S., Dunaev, J., Todhunter-Reid, A., Brawner, B., & Stewart, J. (2017). Social media use and sexual risk reduction behavior among minority youth: Seeking safe sex information. Nursing Research, 66(5), 368���377. https://doi.org/10.1097/NNR.0000000000000237 [DOI: 10.1097/NNR.0000000000000237]
  90. Stinson, R. D. (2010). Hooking up in young adulthood: A review of factors influencing the sexual behavior of college students. Journal of College Student Psychotherapy, 24(2), 98���115. https://doi.org/10.1080/87568220903558596 [DOI: 10.1080/87568220903558596]
  91. Trimble, J. E. (1990). Ethnic specification, validation prospects, and the future of drug use research. International Journal of the Addictions, 25(2A), 149���170. https://doi.org/10.3109/10826089009071038 [DOI: 10.3109/10826089009071038]
  92. Trinh, S. L., & Ward, L. M. (2016). The nature and impact of gendered patterns of peer sexual communications among heterosexual emerging adults. Journal of Sex Research, 53(3), 298���308. https://doi.org/10.1080/00224499.2015.1015715 [DOI: 10.1080/00224499.2015.1015715]
  93. Tucker, L. R., & Lewis, C. (1973). A reliability coefficient for maximum likelihood factor analysis. Psychometrika, 38, 1���10. https://doi.org/10.1007/BF02291170 [DOI: 10.1007/BF02291170]
  94. van de Bongardt, D., Reitz, E., Sandfort, T., & Dekovi��, M. (2015). A meta-analysis of the relations between three types of peer norms and adolescent sexual behavior. Personality and Social Psychology Review, 19(3), 203���234. https://doi.org/10.1177/1088868314544223 [DOI: 10.1177/1088868314544223]
  95. Veale, H. J., Sacks-Davis, R., Weaver, E. R., Pedrana, A. E., Stoov��, M. A., & Hellard, M. E. (2015). The use of social networking platforms for sexual health promotion: Identifying key strategies for successful user engagement. BMC Public Health, 15, 85. https://doi.org/10.1186/s12889-015-1396-z [DOI: 10.1186/s12889-015-1396-z]
  96. Vladutiu, C. J., Martin, S. L., & Macy, R. J. (2011). College-or university-based sexual assault prevention programs: A review of program outcomes, characteristics, and recommendations. Trauma, Violence & Abuse, 12(2), 67���86. https://doi.org/10.1177/1524838010390708 [DOI: 10.1177/1524838010390708]
  97. Whitfield, C., Jomeen, J., Hayter, M., & Gardiner, E. (2013). Sexual health information seeking: A survey of adolescent practices. Journal of Clinical Nursing, 22(23���24), 3259���3269. https://doi.org/10.1111/jocn.12192 [DOI: 10.1111/jocn.12192]
  98. Widman, L., Choukas-Bradley, S., Helms, S. W., Golin, C. E., & Prinstein, M. J. (2014). Sexual communication between early adolescents and their dating partners, parents, and best friends. Journal of Sex Research, 51(7), 731���741. https://doi.org/10.1080/00224499.2013.843148 [DOI: 10.1080/00224499.2013.843148]
  99. Widman, L., Choukas-Bradley, S., Noar, S. M., Nesi, J., & Garrett, K. (2016). Parent-adolescent sexual communication and adolescent safer sex behavior: A meta-analysis. JAMA Pediatrics, 170(1), 52���61. https://doi.org/10.1001/jamapediatrics.2015.2731 [DOI: 10.1001/jamapediatrics.2015.2731]
  100. Wong, T., Pharr, J. R., Bungum, T., Coughenour, C., & Lough, N. L. (2019). Effects of peer sexual health education on college campuses: A systematic review. Health Promotion Practice, 20(5), 652���666. https://doi.org/10.1177/15248399187946 [DOI: 10.1177/15248399187946]
  101. Woody, E. Z., & Costanzo, P. R. (1990). Does marital agony precede marital ecstasy? A comment on Gottman and Krokoff���s ���Marital interaction and satisfaction: A longitudinal view.��� Journal of Consulting and Clinical Psychology, 58(4), 499���501. https://doi.org/10.1037/0022-006X.58.4.499 [DOI: 10.1037/0022-006X.58.4.499]

MeSH Term

Humans
Female
Male
Students
Sexual Behavior
Universities
Young Adult
Cross-Sectional Studies
Health Knowledge, Attitudes, Practice
Risk-Taking
Adolescent
United States
Adult
Socialization
Peer Group
Learning
Friends
Sex Education
Journal Article
Article has an altmetric score of 1

Word Cloud

Created with Highcharts 10.0.0sexuallearningcollegeSexualattitudesknowledgesocializationmothersbehaviorprimaryfriends/peersriskyassociatedtheoryagentsonlinemediaemerging6monthssexliberalgreaterLearningdifferentlivingroleRiskyexploratorycross-sectionalstudyguidedexaminedrelationsfouriefathersLatent-variablestructuralequationmodelstestedusingself-reportdataobtained515adultsspentleastattendingin-personclassesResultsshowedconservativelowerlinkedincreasedaccountshiftpatternsentrycreatedalgebraicdifferencescoressourceinformationGreaterreliancepastrelativeAdditionalanalysesrevealedeffectscampusvscommutershomediscussionemphasizesplaysadults'developmentincludingprotectiveimpactfriendspeersshiftingdynamicsprocessesSexDifferentSources:ImplicationsAttitudesKnowledgeBehaviorAmongUSCollegeStudentsEmergingadulthoodPrimary

Similar Articles

Cited By