OpenLB
Open Library of Bioscience
Advanced Search
Maternal and child health journal
Oct, 2024;28 (10): 1768-1781.

The Impact of a Lifestyle Intervention on Cardiometabolic Risk Factors among Postpartum Hispanic Women with Overweight and Obesity in a Randomized Controlled Trial (Proyecto Mamá).

Kathryn A Wagner, Penelope Pekow, Bess Marcus, Milagros C Rosal, Barry Braun, JoAnn E Manson, Brian W Whitcomb, Lynnette Leidy Sievert, Lisa Chasan-Taber
Author Information
  1. Kathryn A Wagner: Department of Biostatistics and Epidemiology, School of Public Health and Health Sciences, University of Massachusetts Amherst, 401 Arnold House, 715 North Pleasant Street, Amherst, MA, 01003, USA. kathryn.wagner@nih.gov. ORCID
  2. Penelope Pekow: Department of Biostatistics and Epidemiology, School of Public Health and Health Sciences, University of Massachusetts Amherst, 401 Arnold House, 715 North Pleasant Street, Amherst, MA, 01003, USA.
  3. Bess Marcus: Department of Behavioral and Social Sciences, Brown University School of Public Health, Providence, RI, USA.
  4. Milagros C Rosal: Division of Preventive and Behavioral Medicine, Department of Population & Quantitative Health Sciences, University of Massachusetts Chan Medical School, Worcester, MA, USA.
  5. Barry Braun: Department of Health & Exercise Science, Colorado State University, Fort Collins, CO, USA.
  6. JoAnn E Manson: Department of Medicine, Brigham and Women's Hospital, Harvard Medical School, Boston, MA, USA.
  7. Brian W Whitcomb: Department of Biostatistics and Epidemiology, School of Public Health and Health Sciences, University of Massachusetts Amherst, 401 Arnold House, 715 North Pleasant Street, Amherst, MA, 01003, USA.
  8. Lynnette Leidy Sievert: Department of Anthropology, University of Massachusetts Amherst, Amherst, MA, USA.
  9. Lisa Chasan-Taber: Department of Biostatistics and Epidemiology, School of Public Health and Health Sciences, University of Massachusetts Amherst, 401 Arnold House, 715 North Pleasant Street, Amherst, MA, 01003, USA.
PMID: 39110333 DOI: 10.1007/s10995-024-03978-4

Abstract

INTRODUCTION: Maternal overweight or obesity has been associated with metabolic syndrome through 1 year postpartum, but it remains unknown whether a culturally-modified, motivationally-targeted, and individually-tailored Lifestyle Intervention could improve postpartum cardiometabolic health among Hispanic women with overweight or obesity.
METHODS: Proyecto Mamá was a randomized controlled trial conducted in Western Massachusetts from 2014 to 2020 in which Hispanic women with overweight/obesity were randomized to a Lifestyle Intervention (LI) involving diet and exercise or to a comparison Health and Wellness Intervention (HW). Biomarkers of cardiovascular risk (i.e., lipids, C-reactive protein) and insulin resistance (fasting insulin, glucose, HbA1c, homeostasis model assessment [HOMA-IR], leptin, adiponectin) were measured at baseline (early pregnancy), mid-pregnancy, and 6 weeks, 6 months, and 12 months postpartum. Generalized linear mixed effect models were used to evaluate differences in the change in biomarkers over the course of postpartum follow-up time.
RESULTS: In intent-to-treat analyses among eligible women (LI; n=51, HW; n=58) there were no significant differences in changes in biomarkers of CVD risk or insulin resistance over the postpartum year; for example, the intervention effect for total cholesterol was 6.98 (SE: 6.36, p=0.27) and for HbA1c was -0.01 (SE: 0.4, p=0.85). In pooled analyses, regardless of intervention arm, women who participated in any vigorous activity had less of an increase in HbA1c (intervention effect = -0.17, SE: 0.05, p=0.002) compared to those with no vigorous activity, and similarly beneficial associations with other cardiovascular risk biomarkers (p<0.05).
DISCUSSION: Women who participated in vigorous activity, regardless of their assigned intervention arm, had more favorable changes in biomarkers of insulin resistance.

Keywords

Cardiometabolic biomarkers Exercise High BMI Pregnant

References

  1. ACOG. (2020). Physical activity and exercise during pregnancy and the postpartum period: ACOG Committee Opinion, Number 804. Obstetrics & Gynecology, 135, e178-188. [DOI: 10.1097/AOG.0000000000003772]
  2. ADA. Understanding diabetes diagnosis. https://diabetes.org/diabetes/a1c/diagnosis
  3. Allen, J. A., Li, R., Scanlon, K. S., Perrine, C. G., Chen, J., Odom, E., & Black, C. (2013). Progress in increasing breastfeeding and reducing racial/ethnic differences-United States, 2000–2008 births. MMWR Morbidity and Mortality Weekly Report, 62(5), 77–80. [>PMCID: ]
  4. Bandura, A. (1997). Self-efficacy: The exercise of control. W H Freeman/Times Books/Henry Holt & Co.
  5. Barcelona de Mendoza, V., Harville, E., Theall, K., Buekens, P., & Chasan-Taber, L. (2016). Acculturation and Intention to breastfeed among a population of predominantly puerto rican women. Birth, 43(1), 78–85. https://doi.org/10.1111/birt.12199 [DOI: 10.1111/birt.12199]
  6. Bonomo, M., Gandini, M. L., Mastropasqua, A., Begher, C., Valentini, U., Faden, D., & Morabito, A. (1998). Which cutoff level should be used in screening for glucose intolerance in pregnancy? definition of screening methods for gestational diabetes study group of the lombardy section of the italian society of diabetology. American Journal of Obstetrics and Gynecology, 179(1), 179–185. https://doi.org/10.1016/s0002-9378(98)70270-4 [DOI: 10.1016/s0002-9378(98)70270-4]
  7. CDC. (2020). National Diabetes Statistics Report
  8. Chapman, D. J., & Pérez-Escamilla, R. (2012). Breastfeeding among minority women: Moving from risk factors to interventions. Advances in Nutrition, 3(1), 95–104. https://doi.org/10.3945/an.111.001016 [DOI: 10.3945/an.111.001016]
  9. Chasan-Taber, L., Marcus, B. H., Rosal, M. C., Tucker, K. L., Hartman, S. J., Pekow, P., Stanek, E., 3rd., Braun, B., Solomon, C. G., Manson, J. E., Goff, S. L., & Markenson, G. (2015). Proyecto Mamá: A lifestyle intervention in overweight and obese Hispanic women: a randomised controlled trial: Study protocol. BMC Pregnancy and Childbirth, 15, 157. https://doi.org/10.1186/s12884-015-0575-3 [DOI: 10.1186/s12884-015-0575-3]
  10. Chasan-Taber, L., Marcus, B. H., Stanek, E., 3rd., Ciccolo, J. T., Marquez, D. X., Solomon, C. G., & Markenson, G. (2009). A randomized controlled trial of prenatal physical activity to prevent gestational diabetes: Design and methods. Journal of Women’s Health, 18(6), 851–859. https://doi.org/10.1089/jwh.2008.1006 [DOI: 10.1089/jwh.2008.1006]
  11. Chasan-Taber, L., Park, S., Marcotte, R. T., Staudenmayer, J., Strath, S., & Freedson, P. S. (2023). Update and novel validation of a pregnancy physical activity questionnaire. American Journal of Epidemiology. https://doi.org/10.1093/aje/kwad130 [DOI: 10.1093/aje/kwad130]
  12. Chasan-Taber, L., Schmidt, M. D., Roberts, D. E., Hosmer, D., Markenson, G., & Freedson, P. S. (2004). Development and validation of a pregnancy physical activity questionnaire. Medicine & Science in Sports & Exercise, 36(10), 1750–1760. https://doi.org/10.1249/01.mss.0000142303.49306.0d [DOI: 10.1249/01.mss.0000142303.49306.0d]
  13. Chiang, A. N., Yang, M. L., Hung, J. H., Chou, P., Shyn, S. K., & Ng, H. T. (1995). Alterations of serum lipid levels and their biological relevances during and after pregnancy. Life Sciences, 56(26), 2367–2375. https://doi.org/10.1016/0024-3205(95)00230-4 [DOI: 10.1016/0024-3205(95)00230-4]
  14. Cohen, J. (1988). Statistical power analysis for the behavioral sciences (2nd ed.). Lawrence Earlbaum Associates.
  15. Cox, J. L., Holden, J. M., & Sagovsky, R. (1987). Detection of postnatal depression. development of the 10-item edinburgh postnatal depression scale. British Journal of Psychiatry, 150, 782–786. https://doi.org/10.1192/bjp.150.6.782 [DOI: 10.1192/bjp.150.6.782]
  16. Daviglus, M. L., Talavera, G. A., Avilés-Santa, M. L., Allison, M., Cai, J., Criqui, M. H., Gellman, M., Giachello, A. L., Gouskova, N., Kaplan, R. C., LaVange, L., Penedo, F., Perreira, K., Pirzada, A., Schneiderman, N., Wassertheil-Smoller, S., Sorlie, P. D., & Stamler, J. (2012). Prevalence of major cardiovascular risk factors and cardiovascular diseases among Hispanic/Latino individuals of diverse backgrounds in the United States. JAMA, 308(17), 1775–1784. https://doi.org/10.1001/jama.2012.14517 [DOI: 10.1001/jama.2012.14517]
  17. Ennis, S. R., Ríos-Vargas, M., & Albert, N. G. (2011). The Hispanic Population: 2010. 2010 Census Briefs. http://www.census.gov/prod/cen2010/briefs/c2010br-04.pdf
  18. Flores, A. (2017). How the U.S. Hispanic population is changing. http://www.pewresearch.org/fact-tank/2017/09/18/how-the-u-s-hispanic-population-is-changing
  19. Garnæs, K. K., Mørkved, S., Salvesen, K. Å., Salvesen, Ø., & Moholdt, T. (2018). Exercise training during pregnancy reduces circulating insulin levels in overweight/obese women postpartum: Secondary analysis of a randomised controlled trial (the ETIP trial). BMC Pregnancy and Childbirth, 18(1), 18. https://doi.org/10.1186/s12884-017-1653-5 [DOI: 10.1186/s12884-017-1653-5]
  20. Gubrium, A., Leckenby, D., Harvey, M. W., Marcus, B. H., Rosal, M. C., & Chasan-Taber, L. (2019). Perspectives of health educators and interviewers in a randomzied controlled trial of a postpartum diabetes prevention program for Latinas: A qualitative assessment. BMC Health Services Research, 19(1), 357. https://doi.org/10.1186/s12913-019-4207-x [DOI: 10.1186/s12913-019-4207-x]
  21. Hardie, L., Trayhurn, P., Abramovich, D., & Fowler, P. (1997). Circulating leptin in women: A longitudinal study in the menstrual cycle and during pregnancy. Clinical Endocrinology, 47(1), 101–106. https://doi.org/10.1046/j.1365-2265.1997.2441017.x [DOI: 10.1046/j.1365-2265.1997.2441017.x]
  22. Hay, W. W., Jr. (2006). Placental-fetal glucose exchange and fetal glucose metabolism. Transactions of the American Clinical Climatological Association, 117, 321–340. [PMID: 18528484]
  23. Heiss, G., Snyder, M. L., Teng, Y., Schneiderman, N., Llabre, M. M., Cowie, C., Carnethon, M., Kaplan, R. C., Giachello, A. L., Gallo, L., Loehr, L., & Avilés-Santa, M. L. (2014). Prevalence of metabolic syndrome among Hispanic/Latinos of diverse background: The Hispanic community health study/study of Latinos. Diabetes Care, 37(8), 2391–2399. https://doi.org/10.2337/dc13-2505 [DOI: 10.2337/dc13-2505]
  24. Highman, T. J., Friedman, J. E., Huston, L. P., Wong, W. W., & Catalano, P. M. (1998). Longitudinal changes in maternal serum leptin concentrations, body composition, and resting metabolic rate in pregnancy. American Journal of Obstetrics and Gynecology, 178(5), 1010–1015. https://doi.org/10.1016/s0002-9378(98)70540-x [DOI: 10.1016/s0002-9378(98)70540-x]
  25. Hoppu, U., Isolauri, E., Koskinen, P., & Laitinen, K. (2014). Maternal dietary counseling reduces total and LDL cholesterol postpartum. Nutrition, 30(2), 159–164. https://doi.org/10.1016/j.nut.2013.07.009 [DOI: 10.1016/j.nut.2013.07.009]
  26. Jadresic, E., Araya, R., & Jara, C. (1995). Validation of the Edinburgh postnatal depression scale (EPDS) in Chilean postpartum women. Journal of Psychosomatic Obstetrics & Gynecology, 16(4), 187–191. https://doi.org/10.3109/01674829509024468 [DOI: 10.3109/01674829509024468]
  27. Julious, S. A. (2010). Sample Sizes for Clinical Trials. Chapman & Hall/CRC.
  28. Lichtenstein, A. H., Appel, L. J., Brands, M., Carnethon, M., Daniels, S., Franch, H. A., Franklin, B., Kris-Etherton, P., Harris, W. S., Howard, B., Karanja, N., Lefevre, M., Rudel, L., Sacks, F., Van Horn, L., Winston, M., & Wylie-Rosett, J. (2006). Diet and lifestyle recommendations revision 2006: A scientific statement from the American heart association nutrition committee. Circulation, 114(1), 82–96. https://doi.org/10.1161/CIRCULATIONAHA.106.176158 [DOI: 10.1161/CIRCULATIONAHA.106.176158]
  29. Mann, S., Beedie, C., & Jimenez, A. (2014). Differential effects of aerobic exercise, resistance training and combined exercise modalities on cholesterol and the lipid profile: review, synthesis and recommendations. Sports Medicine, 44(2), 211–221. https://doi.org/10.1007/s40279-013-0110-5 [DOI: 10.1007/s40279-013-0110-5]
  30. Marcus, B. H., Lewis, B. A., Williams, D. M., Dunsiger, S., Jakicic, J. M., Whiteley, J. A., Albrecht, A. E., Napolitano, M. A., Bock, B. C., Tate, D. F., Sciamanna, C. N., & Parisi, A. F. (2007a). A comparison of Internet and print-based physical activity interventions. Archives of Internal Medicine, 167(9), 944–949. https://doi.org/10.1001/archinte.167.9.944 [DOI: 10.1001/archinte.167.9.944]
  31. Marcus, B. H., Lewis, B. A., Williams, D. M., Whiteley, J. A., Albrecht, A. E., Jakicic, J. M., Parisi, A. F., Hogan, J. W., Napolitano, M. A., & Bock, B. C. (2007b). Step into motion: A randomized trial examining the relative efficacy of Internet vs print-based physical activity interventions. Contemporary Clinical Trials, 28(6), 737–747. https://doi.org/10.1016/j.cct.2007.04.003 [DOI: 10.1016/j.cct.2007.04.003]
  32. Marcus, B. H., Napolitano, M. A., King, A. C., Lewis, B. A., Whiteley, J. A., Albrecht, A. E., Parisi, A. F., Bock, B. C., Pinto, B., Sciamanna, C. N., Jakicic, J. M., & Papandonatos, G. D. (2007c). Telephone versus print delivery of an individualized motivationally tailored physical activity intervention: Project STRIDE. Health Psychology, 26(4), 401–409. https://doi.org/10.1037/0278-6133.26.4.401 [DOI: 10.1037/0278-6133.26.4.401]
  33. Martin, J., MacDonald-Wicks, L., Hure, A., Smith, R., & Collins, C. E. (2015). Reducing postpartum weight retention and improving breastfeeding outcomes in overweight women: a pilot randomised controlled trial. Nutrients, 7(3), 1464–1479. https://doi.org/10.3390/nu7031464 [DOI: 10.3390/nu7031464]
  34. Michel, S., Raab, R., Drabsch, T., Günther, J., Stecher, L., & Hauner, H. (2019). Do lifestyle interventions during pregnancy have the potential to reduce long-term postpartum weight retention? A systematic review and meta-analysis. Obesity Reviews, 20(4), 527–542. https://doi.org/10.1111/obr.12809 [DOI: 10.1111/obr.12809]
  35. Mills, H. L., Patel, N., White, S. L., Pasupathy, D., Briley, A. L., Santos Ferreira, D. L., Seed, P. T., Nelson, S. M., Sattar, N., Tilling, K., Poston, L., & Lawlor, D. A. (2019). The effect of a lifestyle intervention in obese pregnant women on gestational metabolic profiles: Findings from the UK pregnancies better eating and activity trial (UPBEAT) randomised controlled trial. BMC Medicine, 17(1), 15. https://doi.org/10.1186/s12916-018-1248-7 [DOI: 10.1186/s12916-018-1248-7]
  36. Motel, S., & Patten, E. (2012). The 10 Largest Hispanic Origin Groups: Characteristics, Rankings, Top Counties. https://www.pewresearch.org/hispanic/2012/06/27/the-10-largest-hispanic-origin-groups-characteristics-rankings-top-counties/#:~:text=Overall%2C%20the%2010%20largest%20Hispanic,of%20the%20U.S.%20Hispanic%20population.&text=Six%20Hispanic%20origin%20groups%20have%20populations%20greater%20than%201%20million .
  37. Muktabhant, B., Lawrie, T. A., Lumbiganon, P., & Laopaiboon, M. (2015). Diet or exercise, or both, for preventing excessive weight gain in pregnancy. Cochrane Database Systematic Reviews. https://doi.org/10.1002/14651858.CD007145.pub3 [DOI: 10.1002/14651858.CD007145.pub3]
  38. NCEP. (2001). Executive summary of the third report of the national cholesterol education program (NCEP) expert panel on detection, evaluation, and treatment of high blood cholesterol in adults (adult treatment panel III). JAMA, 285(19), 2486–2497. https://doi.org/10.1001/jama.285.19.2486 [DOI: 10.1001/jama.285.19.2486]
  39. Nicklas, J. M., Zera, C. A., Seely, E. W., Abdul-Rahim, Z. S., Rudloff, N. D., & Levkoff, S. E. (2011). Identifying postpartum intervention approaches to prevent type 2 diabetes in women with a history of gestational diabetes. BMC Pregnancy and Childbirth, 11, 23. https://doi.org/10.1186/1471-2393-11-23 [DOI: 10.1186/1471-2393-11-23]
  40. Nielsen, L. R., Ekbom, P., Damm, P., Glümer, C., Frandsen, M. M., Jensen, D. M., & Mathiesen, E. R. (2004). HbA1c levels are significantly lower in early and late pregnancy. Diabetes Care, 27(5), 1200–1201. https://doi.org/10.2337/diacare.27.5.1200 [DOI: 10.2337/diacare.27.5.1200]
  41. Pachón, H., & Olson, C. (1999). Retrospective analysis of exclusive breastfeeding practices among four Hispanic subgroups in New York’s EFNEP. Journal of Nutrition Education, 31(1), 39–46. [DOI: 10.1016/S0022-3182(99)70383-3]
  42. Palnati, M., Marcus, B. H., Pekow, P., Rosal, M. C., Manson, J. E., & Chasan-Taber, L. (2021). The impact of a lifestyle intervention on postpartum weight retention among at-risk hispanic women. American Journal of Preventive Medicine, 61(1), 44–54. https://doi.org/10.1016/j.amepre.2021.02.005 [DOI: 10.1016/j.amepre.2021.02.005]
  43. Powles, K., & Gandhi, S. (2017). Postpartum hypertension. CMAJ, 189(27), E913. https://doi.org/10.1503/cmaj.160785 [DOI: 10.1503/cmaj.160785]
  44. Prochaska, J. O., & DiClemente, C. C. (1982). Transtheoretical therapy: Towards a more integrative model of change. Psychotherapy: Theory, Research & Practice, 19(3), 276–288. https://doi.org/10.1037/h0088437 [DOI: 10.1037/h0088437]
  45. Puhkala, J., Kinnunen, T. I., Vasankari, T., Kukkonen-Harjula, K., Raitanen, J., & Luoto, R. (2013). Prevalence of metabolic syndrome one year after delivery in Finnish women at increased risk for gestational diabetes mellitus during pregnancy. Journal of Pregnancy, 2013, 139049. https://doi.org/10.1155/2013/139049 [DOI: 10.1155/2013/139049]
  46. Ramírez-Vélez, R., Lobelo, F., Auilar-de Plata, A. C., Izquierdo, M., & García-Hermoso, A. (2017). Exercise during pregnancy on maternal lipids: A secondary analysis of randomized controlled trial. BMC Pregnancy and Childbirth, 17(1), 396. https://doi.org/10.1186/s12884-017-1571-6 [DOI: 10.1186/s12884-017-1571-6]
  47. Rasmussen, K. M., & Yaktine, A. L. (2009). Weight gain during pregnancy. National Academies Press.
  48. Renault, K. M., Carlsen, E. M., Hædersdal, S., Nilas, L., Secher, N. J., Eugen-Olsen, J., Cortes, D., Olsen, S. F., Halldorsson, T. I., & Nørgaard, K. (2017). Impact of lifestyle intervention for obese women during pregnancy on maternal metabolic and inflammatory markers. International Journal of Obesity, 41(4), 598–605. https://doi.org/10.1038/ijo.2017.9 [DOI: 10.1038/ijo.2017.9]
  49. Retnakaran, R., Qi, Y., Sermer, M., Connelly, P. W., Hanley, A. J., & Zinman, B. (2011). The postpartum cardiovascular risk factor profile of women with isolated hyperglycemia at 1-hour on the oral glucose tolerance test in pregnancy. Nutrition, Metabolism and Cardiovascular Diseases, 21(9), 706–712. https://doi.org/10.1016/j.numecd.2011.02.010 [DOI: 10.1016/j.numecd.2011.02.010]
  50. Sacks, D. B. (1999). Carbohydrates. In Tietz Textbook of Clinical Chemistry (3 ed., pp. 750–808). Saunders
  51. Skajaa, G. O., Fuglsang, J., Knorr, S., Møller, N., Ovesen, P., & Kampmann, U. (2020). Changes in insulin sensitivity and insulin secretion during pregnancy and post partum in women with gestational diabetes. BMJ Open Diabetes Research and Care, 8(2), e001728. https://doi.org/10.1136/bmjdrc-2020-001728 [DOI: 10.1136/bmjdrc-2020-001728]
  52. Sorlie, P. D., Allison, M., Avilés-Santa, M. L., Cai, J., Daviglus, M. L., Howard, A. G., Kaplan, R. C., Lavange, L. M., Raij, L., Schneiderman, N., Wassertheil-Smoller, S., & Talavera, G. A. (2014). Prevalence of hypertension, awareness, treatment, and control in the Hispanic Community Health Study/Study of Latinos. American Journal of Hypertension, 27(6), 793–800. https://doi.org/10.1093/ajh/hpu003 [DOI: 10.1093/ajh/hpu003]
  53. Sui, Z., Moran, L. J., & Dodd, J. M. (2013). Physical activity levels during pregnancy and gestational weight gain among women who are overweight or obese. Health Promotion Journal of Australia, 24(3), 206–213. https://doi.org/10.1071/HE13054 [DOI: 10.1071/HE13054]
  54. Thompson, P. D., Buchner, D., Pina, I. L., Balady, G. J., Williams, M. A., Marcus, B. H., Berra, K., Blair, S. N., Costa, F., Franklin, B., Fletcher, G. F., Gordon, N. F., Pate, R. R., Rodriguez, B. L., Yancey, A. K., & Wenger, N. K. (2003). Exercise and physical activity in the prevention and treatment of atherosclerotic cardiovascular disease: A statement from the Council on Clinical Cardiology (subcommittee on exercise, rehabilitation, and prevention) and the council on nutrition, physical activity, and metabolism (subcommittee on physical activity). Circulation, 107(24), 3109–3116. https://doi.org/10.1161/01.CIR.0000075572.40158.77 [DOI: 10.1161/01.CIR.0000075572.40158.77]
  55. Tropp, L. R., Erkut, S., García Coll, C., Alarcón, O., & Vázquez García, H. A. (1999). Psychological acculturation: Development of a New Measure for Puerto Ricans on the U.S. Mainland. Educational and Psychological Measurement, 59(2), 351–367. https://doi.org/10.1177/00131649921969794 [DOI: 10.1177/00131649921969794]
  56. Vega-López, S., Pignotti, G. A. P., Keller, C., Todd, M., Ainsworth, B., Williams, A. N., Records, K., Coonrod, D., & Permana, P. (2015). Participation in a social-support physical activity intervention modestly improves lipoprotein cholesterol distribution among postpartum Sedentary Hispanic Women. Journal of Physical Activity and Health, 12(9), 1289–1297. https://doi.org/10.1123/jpah.2014-0245 [DOI: 10.1123/jpah.2014-0245]
  57. Vinter, C. A., Jensen, D. M., Ovesen, P., Beck-Nielsen, H., Tanvig, M., Lamont, R. F., & Jørgensen, J. S. (2014). Postpartum weight retention and breastfeeding among obese women from the randomzied controlled Lifestyle in Pregnancy (LiP) trial. Acta Obstetricia Et Gynecologica Scandinavica, 93(8), 794–801. https://doi.org/10.1111/aogs.12429 [DOI: 10.1111/aogs.12429]
  58. Wagner, K. A., Whitcomb, B. W., Marcus, B., Pekow, P., Rosal, M. C., Sievert, L. L., Tucker, K. L., Manson, J. E., & Chasan-Taber, L. (2024). The impact of a lifestyle intervention on postpartum weight retention among US Hispanic women with overweight and obesity. Preventive Medicine Reports, 38, 102633. https://doi.org/10.1016/j.pmedr.2024.102633 [DOI: 10.1016/j.pmedr.2024.102633]
  59. Wang, C., Wei, Y., Zhang, X., Zhang, Y., Xu, Q., Sun, Y., Su, S., Zhang, L., Liu, C., Feng, Y., Shou, C., Guelfi, K. J., Newnham, J. P., & Yang, H. (2017). A randomized clinical trial of exercise during pregnancy to prevent gestational diabetes mellitus and improve pregnancy outcome in overweight and obese pregnant women. American Journal of Obstetrics and Gynecology, 216(4), 340–351. https://doi.org/10.1016/j.ajog.2017.01.037 [DOI: 10.1016/j.ajog.2017.01.037]

Grants

  1. 1R01DK097011/NIDDK NIH HHS
  2. 1R01DK097011/NIDDK NIH HHS

MeSH Term

Humans
Female
Hispanic or Latino
Adult
Postpartum Period
Overweight
Cardiometabolic Risk Factors
Pregnancy
Obesity
Massachusetts
Life Style
Exercise
Insulin Resistance
Biomarkers
Cardiovascular Diseases
Risk Factors
Metabolic Syndrome

Chemicals

Biomarkers
Journal Article Randomized Controlled Trial

Word Cloud

Created with Highcharts 10.0.0postpartumbiomarkersInterventionwomeninsulin6interventionLifestyleamongHispanicriskresistanceHbA1ceffectSE:p=0vigorousactivityoverweightobesityyearProyectoMamárandomizedLIHWcardiovascularmonthsdifferencesanalyseschanges-00regardlessarmparticipated05WomenCardiometabolicINTRODUCTION:Maternalassociatedmetabolicsyndrome1remainsunknownwhetherculturally-modifiedmotivationally-targetedindividually-tailoredimprovecardiometabolichealthMETHODS:controlledtrialconductedWesternMassachusetts20142020overweight/obesityinvolvingdietexercisecomparisonHealthWellnessBiomarkersielipidsC-reactiveproteinfastingglucosehomeostasismodelassessment[HOMA-IR]leptinadiponectinmeasuredbaselineearlypregnancymid-pregnancyweeks12Generalizedlinearmixedmodelsusedevaluatechangecoursefollow-uptimeRESULTS:intent-to-treateligiblen=51n=58significantCVDexampletotalcholesterol98362701485pooledlessincrease=17002comparedsimilarlybeneficialassociationsp<0DISCUSSION:assignedfavorableImpactRiskFactorsPostpartumOverweightObesityRandomizedControlledTrialExerciseHighBMIPregnant

Similar Articles

Cited By