Portimine A toxin causes skin inflammation through ZAK��-dependent NLRP1 inflammasome activation.

L��ana Gorse, Lo��c Plessis, Stephen Wearne, Margaux Paradis, Miriam Pinilla, Rae Chua, Seong Soo Lim, Elena Pelluz, Gee-Ann Toh, Raoul Mazars, Caio Bomfim, Fabienne Herv��, Korian Lhaute, Damien R��veillon, Bastien Suire, L��a Ravon-Katossky, Thomas Benoist, L��a Fromont, David P��ricat, Kenneth Neil Mertens, Am��lie Derrien, Aouregan Terre-Terrillon, Nicolas Chom��rat, Gwena��l Bilien, V��ronique S��chet, Liliane Carpentier, Mamadou Fall, Amidou Sonko, Hadi Hakim, Nfally Sadio, Jessie Bourdeaux, C��line Cougoule, Anthony K Henras, Ana Belen Perez-Oliva, Patrice Brehmer, Francisco J Roca, Franklin L Zhong, John Common, Etienne Meunier, Philipp Hess
Author Information
  1. L��ana Gorse: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France. ORCID
  2. Lo��c Plessis: Ifremer, PHYTOX Physiologie et Toxines des Microalgues Toxiques et Nuisibles, F-44000, Nantes, France. ORCID
  3. Stephen Wearne: A*STAR Skin Research, Institute of Singapore, Agency for Science, Technology and Research (A*STAR) Skin Research Labs, 138648, Singapore, Singapore.
  4. Margaux Paradis: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France. ORCID
  5. Miriam Pinilla: Department of Biochemistry and Molecular Biology-B and Immunology, Infectious Disease Pathology, Clinical Microbiology and Tropical Medicine, University of Murcia, Murcia, Spain. ORCID
  6. Rae Chua: LKC School of Medicine, Nanyang Technological University, Singapore, Singapore.
  7. Seong Soo Lim: A*STAR Skin Research, Institute of Singapore, Agency for Science, Technology and Research (A*STAR) Skin Research Labs, 138648, Singapore, Singapore.
  8. Elena Pelluz: Department of Biochemistry and Molecular Biology-B and Immunology, Infectious Disease Pathology, Clinical Microbiology and Tropical Medicine, University of Murcia, Murcia, Spain. ORCID
  9. Gee-Ann Toh: LKC School of Medicine, Nanyang Technological University, Singapore, Singapore. ORCID
  10. Raoul Mazars: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France.
  11. Caio Bomfim: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France.
  12. Fabienne Herv��: Ifremer, PHYTOX Physiologie et Toxines des Microalgues Toxiques et Nuisibles, F-44000, Nantes, France. ORCID
  13. Korian Lhaute: Ifremer, PHYTOX Physiologie et Toxines des Microalgues Toxiques et Nuisibles, F-44000, Nantes, France. ORCID
  14. Damien R��veillon: Ifremer, PHYTOX Physiologie et Toxines des Microalgues Toxiques et Nuisibles, F-44000, Nantes, France. ORCID
  15. Bastien Suire: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France.
  16. L��a Ravon-Katossky: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France.
  17. Thomas Benoist: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France. ORCID
  18. L��a Fromont: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France. ORCID
  19. David P��ricat: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France.
  20. Kenneth Neil Mertens: Ifremer, COAST Unit, Concarneau, France.
  21. Am��lie Derrien: Ifremer, COAST Unit, Concarneau, France. ORCID
  22. Aouregan Terre-Terrillon: Ifremer, COAST Unit, Concarneau, France.
  23. Nicolas Chom��rat: Ifremer, COAST Unit, Concarneau, France.
  24. Gwena��l Bilien: Ifremer, COAST Unit, Concarneau, France. ORCID
  25. V��ronique S��chet: Ifremer, PHYTOX Physiologie et Toxines des Microalgues Toxiques et Nuisibles, F-44000, Nantes, France. ORCID
  26. Liliane Carpentier: Ifremer, PHYTOX Physiologie et Toxines des Microalgues Toxiques et Nuisibles, F-44000, Nantes, France.
  27. Mamadou Fall: Universit�� Cheikh Anta Diop de Dakar, Laboratoire de Toxicologie et d'hydrologie, Dakar-Fann, Senegal. ORCID
  28. Amidou Sonko: Anti-Poison Centre, Fann University Hospital, Dakar, Senegal.
  29. Hadi Hakim: Private Dermatologist, Dakar, Senegal.
  30. Nfally Sadio: Institut S��n��galais de Recherche Agricole, Centre de Recherche Oc��anographique de Dakar Thiaroye, Dakar, Senegal.
  31. Jessie Bourdeaux: Molecular, Cellular and Developmental (MCD) Unit, Centre for Integrative Biology (CBI), CNRS, University of Toulouse, UPS, Toulouse, France.
  32. C��line Cougoule: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France. ORCID
  33. Anthony K Henras: Molecular, Cellular and Developmental (MCD) Unit, Centre for Integrative Biology (CBI), CNRS, University of Toulouse, UPS, Toulouse, France. ORCID
  34. Ana Belen Perez-Oliva: Biomedical Research, Institute of Murcia (IMIB)-Pascual Parrilla, Murcia, Spain.
  35. Patrice Brehmer: Institut de Recherche pour le D��veloppement, IRD, Univ Brest, CNRS, Ifremer, Dakar, Senegal. Patrice.Brehmer@ird.fr. ORCID
  36. Francisco J Roca: Department of Biochemistry and Molecular Biology-B and Immunology, Infectious Disease Pathology, Clinical Microbiology and Tropical Medicine, University of Murcia, Murcia, Spain. fjroca@um.es. ORCID
  37. Franklin L Zhong: LKC School of Medicine, Nanyang Technological University, Singapore, Singapore. franklin.zhong@ntu.edu.sg. ORCID
  38. John Common: A*STAR Skin Research, Institute of Singapore, Agency for Science, Technology and Research (A*STAR) Skin Research Labs, 138648, Singapore, Singapore. john.common@newcastle.ac.uk. ORCID
  39. Etienne Meunier: Institute of Pharmacology and Structural Biology (IPBS), University of Toulouse, CNRS, Toulouse, France. etienne.meunier@ipbs.fr. ORCID
  40. Philipp Hess: Ifremer, PHYTOX Physiologie et Toxines des Microalgues Toxiques et Nuisibles, F-44000, Nantes, France. philipp.hess@ifremer.fr. ORCID

Abstract

In 2020-2021, a "mysterious illness" struck Senegalese fishermen, causing severe acute dermatitis in over one thousand individuals following exposure through drift-net fishing activity. Here, by performing deep analysis of the environmental samples we reveal the presence of the marine dinoflagellate Vulcanodinium rugosum and its associated cyclic imine toxins. Specifically, we show that the toxin PortimineA, strongly enriched in environmental samples, impedes ribosome function in human keratinocytes, which subsequently activates the stress kinases ZAK�� and P38 and promotes the nucleation of the human NLRP1 inflammasome, leading to the release of IL-1��/IL-18 pro-inflammatory cytokines and cell death. Furthermore, cell-based models highlight that naturally occurring mutations in the P38-targeted sites of human NLRP1 are unable to respond to PortimineA exposure. Finally, the development and use of human organotypic skins and zebrafish models of PortimineA exposure demonstrate that the ZAK��-NLRP1 axis drives skin necrosis and inflammation. Our results exemplify the threats to human health caused by emerging environmental toxins and identify ZAK�� and NRLP1 as important pharmacological targets to mitigate PortimineA toxicity.

Keywords

References

  1. Cell Rep. 2023 Jan 31;42(1):111966 [PMID: 36649710]
  2. EFSA J. 2022 May 25;20(Suppl 1):e200422 [PMID: 35634545]
  3. ACS Med Chem Lett. 2018 Dec 26;10(2):175-179 [PMID: 30783499]
  4. J Exp Med. 2023 Oct 2;220(10): [PMID: 37642996]
  5. J Exp Med. 2024 Aug 5;221(8): [PMID: 38861480]
  6. J Immunol. 2018 Oct 1;201(7):1946-1966 [PMID: 30150286]
  7. Mar Drugs. 2024 Mar 05;22(3): [PMID: 38535463]
  8. Mol Biol Rep. 1973 Jun;1(1):15-20 [PMID: 24197425]
  9. Nature. 2015 Oct 29;526(7575):666-71 [PMID: 26375259]
  10. Science. 2021 Nov 26;374(6571):1076-1080 [PMID: 34822265]
  11. Toxicol In Vitro. 2021 Jun;73:105125 [PMID: 33631200]
  12. Apoptosis. 2016 Dec;21(12):1447-1452 [PMID: 27738771]
  13. Proc Natl Acad Sci U S A. 2023 Jan 31;120(5):e2213777120 [PMID: 36693106]
  14. Cell. 2019 Sep 5;178(6):1344-1361.e11 [PMID: 31474371]
  15. Harmful Algae. 2021 Feb;102:101843 [PMID: 33875177]
  16. Sci Total Environ. 2021 Feb 25;757:143782 [PMID: 33229082]
  17. Mar Pollut Bull. 2023 May;190:114878 [PMID: 37002965]
  18. J Invest Dermatol. 2018 Dec;138(12):2507-2510 [PMID: 30466537]
  19. Methods Enzymol. 2016;569:287-308 [PMID: 26778564]
  20. Harmful Algae. 2018 May;75:75-86 [PMID: 29778227]
  21. J Exp Med. 2023 Jan 2;220(1): [PMID: 36315050]
  22. EMBO Mol Med. 2023 Oct 11;15(10):e18142 [PMID: 37675820]
  23. Harmful Algae. 2020 Jan;91:101590 [PMID: 32057338]
  24. Biol Rev Camb Philos Soc. 2015 Aug;90(3):837-53 [PMID: 25155196]
  25. Toxins (Basel). 2023 Mar 11;15(3): [PMID: 36977108]
  26. EBioMedicine. 2023 Jul;93:104604 [PMID: 37164781]
  27. Harmful Algae. 2023 Nov;129:102500 [PMID: 37951616]
  28. Dev Cell. 2018 Jul 2;46(1):112-125.e4 [PMID: 29974860]
  29. J Mar Biol Assoc U K. 2015;2015: [PMID: 26692586]
  30. Science. 2022 Jul 15;377(6603):328-335 [PMID: 35857590]
  31. Immunity. 2024 Apr 9;57(4):674-699 [PMID: 38599165]
  32. BMC Genet. 2009 Feb 17;10:5 [PMID: 19222838]
  33. Toxicon. 2012 Nov;60(6):995-9 [PMID: 22813782]
  34. J Biol Chem. 2018 Dec 7;293(49):18864-18878 [PMID: 30291141]
  35. Mar Drugs. 2023 Jul 29;21(8): [PMID: 37623710]
  36. Cell. 2020 Jul 23;182(2):404-416.e14 [PMID: 32610081]
  37. Mol Cell. 2002 Aug;10(2):417-26 [PMID: 12191486]
  38. J Med Chem. 2020 Mar 12;63(5):2114-2130 [PMID: 31244114]
  39. Nature. 2021 Mar;591(7848):131-136 [PMID: 33472215]
  40. Cell. 2024 Jul 11;187(14):3652-3670.e40 [PMID: 38843833]
  41. Nature. 2015 Oct 29;526(7575):660-5 [PMID: 26375003]
  42. Proc Natl Acad Sci U S A. 2024 Jan 9;121(2):e2309579121 [PMID: 38175865]
  43. FEBS Lett. 2024 Jun;598(11):1335-1353 [PMID: 38485451]
  44. Mol Cell. 2020 May 21;78(4):700-713.e7 [PMID: 32289254]
  45. Science. 2021 Nov 26;374(6571):1070-1075 [PMID: 34822279]
  46. Science. 2021 Jan 29;371(6528): [PMID: 33243852]
  47. Nat Protoc. 2013 Jun;8(6):1114-24 [PMID: 23680983]
  48. Am J Hum Genet. 2012 Jul 13;91(1):27-37 [PMID: 22748209]
  49. J Exp Med. 2023 Oct 2;220(10): [PMID: 37642997]
  50. Nature. 2023 Oct;622(7983):507-513 [PMID: 37730997]
  51. Trends Immunol. 2024 Apr;45(4):248-258 [PMID: 38519271]
  52. Toxins (Basel). 2020 Jan 28;12(2): [PMID: 32012834]
  53. Sci Immunol. 2022 Nov 11;7(77):eabm7200 [PMID: 36332009]

Grants

  1. INFLAME 804249/EC | ERC | HORIZON EUROPE European Research Council (ERC)
  2. PSICOPAK/Agence Nationale de la Recherche (ANR)
  3. INFLAMATOX/Agence Nationale de la Recherche (ANR)
  4. COMETH-/Agence Nationale de la Recherche (ANR)
  5. AJE20151034460/Fondation pour la Recherche M��dicale (FRM)
  6. CIFRE/Association Nationale de la Recherche et de la Technologie (ANRT)
  7. LCF/PR/HR21/52410027/la Caixa' Foundation
  8. PID2022-139754OB-I00/'la Caixa' Foundation ('la Caixa')
  9. RYC2019-571 027799-I/'la Caixa' Foundation ('la Caixa')
  10. 01DG12073E/Institut de Recherche pour le D��veloppement (IRD)
  11. H22J1a0040/Asian Skin Microbiome Programme 2.0 IAF-PP
  12. MOH-001499/MOH | National Medical Research Council (NMRC)
  13. RT23/23/Ministry of Education Tier 1 grant
  14. MOE-T2EP30222-0008/Ministry of Education Tier 2
  15. PHYTOX-R306-01/Institut Fran��ais de Recherche pour l'Exploitation de la Mer (IFREMER)
  16. Awatox/Art Sunu Gueej initiative/01DG12073E/Institut Fran��ais de Recherche pour l'Exploitation de la Mer (IFREMER)

MeSH Term

Humans
Inflammasomes
Animals
Zebrafish
Keratinocytes
NLR Proteins
Marine Toxins
Dinoflagellida
Skin
Interleukin-1beta
Dermatitis
YAP-Signaling Proteins
Adaptor Proteins, Signal Transducing
Inflammation
Furans
Sulfonamides
Indenes
Transcription Factors
Cell Cycle Proteins

Chemicals

Inflammasomes
NLRP1 protein, human
NLR Proteins
Marine Toxins
N-(1,2,3,5,6,7-hexahydro-S-indacen-4-ylcarbamoyl)-4-(2-hydroxy-2-propanyl)-2-furansulfonamide
YY1AP1 protein, human
Interleukin-1beta
YAP-Signaling Proteins
Adaptor Proteins, Signal Transducing
Furans
Sulfonamides
Indenes
Transcription Factors
Cell Cycle Proteins

Word Cloud

Created with Highcharts 10.0.0humanPortimineANLRP1exposureenvironmentalsamplestoxinstoxinZAK��inflammasomemodelsskininflammation2020-2021"mysteriousillness"struckSenegalesefishermencausingsevereacutedermatitisonethousandindividualsfollowingdrift-netfishingactivityperformingdeepanalysisrevealpresencemarinedinoflagellateVulcanodiniumrugosumassociatedcyclicimineSpecificallyshowstronglyenrichedimpedesribosomefunctionkeratinocytessubsequentlyactivatesstresskinasesP38promotesnucleationleadingreleaseIL-1��/IL-18pro-inflammatorycytokinescelldeathFurthermorecell-basedhighlightnaturallyoccurringmutationsP38-targetedsitesunablerespondFinallydevelopmentuseorganotypicskinszebrafishdemonstrateZAK��-NLRP1axisdrivesnecrosisresultsexemplifythreatshealthcausedemergingidentifyNRLP1importantpharmacologicaltargetsmitigatetoxicityPortiminecausesZAK��-dependentactivationEnvironmentalToxinsInflammasomeRibotoxicStressResponseSkinPathology

Similar Articles

Cited By