HPK1 kinase inhibitor: a sufficient approach to target HPK1 to modulate T cell activation in cancer immunotherapy compared with degraders.

Qin Wang, Xinyi Zhu, Jing Li, Sanjia Xu, Ali Wang, Xinwen Zhang, Xingxing Wang, Xiaopeng Cai, Haimei Xing, Ye Liu, Xuesong Liu, Zhiwei Wang, Lai Wang, Xi Yuan
Author Information
  1. Qin Wang: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  2. Xinyi Zhu: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  3. Jing Li: Department of Medicinal Chemistry, BeiGene (Beijing) Co., Ltd., Beijing, China.
  4. Sanjia Xu: Department of Medicinal Chemistry, BeiGene (Beijing) Co., Ltd., Beijing, China.
  5. Ali Wang: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  6. Xinwen Zhang: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  7. Xingxing Wang: Department of Medicinal Chemistry, BeiGene (Beijing) Co., Ltd., Beijing, China.
  8. Xiaopeng Cai: Department of Medicinal Chemistry, BeiGene (Beijing) Co., Ltd., Beijing, China.
  9. Haimei Xing: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  10. Ye Liu: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  11. Xuesong Liu: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  12. Zhiwei Wang: Department of Medicinal Chemistry, BeiGene (Beijing) Co., Ltd., Beijing, China.
  13. Lai Wang: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.
  14. Xi Yuan: Department of Biology, BeiGene (Beijing) Co., Ltd., Beijing, China.

Abstract

Background: Hematopoietic progenitor kinase 1 (HPK1) is a member of the mitogen-activated protein kinase kinase kinase kinase (MAP4K) family. It has been reported that HPK1 negatively regulates the activation of T cells. Several compounds have been developed and tested in clinical trials to target HPK1 for cancer immunotherapy. However, whether kinase inhibition is sufficient to eliminate the immunosuppressive function of HPK1, particularly in T cells, remains elusive.
Methods: In this study, genetic tools were used to edit the human T lymphocyte cell line Jurkat. The activation of HPK1-null cells, HPK1-wildtype cells and HPK1-kinase-inactive cells was compared through ectopic expression of HPK1 in HPK1 knockout cells or direct HPK1 mutation. Besides genetic validation, a series of compounds that selectively target HPK1 (with or without HPK1-degradation activity) were used to assess the potential scaffold function of HPK1 in regulation of human primary T cell activation and cytotoxic activity.
Results and conclusion: Augmented T-cell receptor (TCR)-induced activation in HPK1-knockout Jurkat cells was inhibited by complementation of wildtype, but not kinase-dead HPK1. HPK1 K46E-knockin and K46*-knockin Jurkat cells showed comparable levels of enhanced TCR-induced activation compared with control HPK1-wildtype Jurkat cells. Similarly, HPK1 kinase inhibitor (Compound 1) and cereblon-based (CRBN-based) HPK1 degrader (Compound 2) elicited similar degrees of maximum TCR-induced activation in primary human peripheral blood T cells. In summary, the results of this study suggested that HPK1 kinase inhibitor may be sufficient for HPK1 targeting in T cell mediated cancer immunotherapy.

Keywords

References

  1. J Exp Med. 2007 Mar 19;204(3):681-91 [PMID: 17353368]
  2. Cell Death Differ. 2007 Mar;14(3):568-75 [PMID: 17024227]
  3. J Med Chem. 2023 Dec 14;66(23):16201-16221 [PMID: 37990878]
  4. J Cell Biol. 2011 Nov 28;195(5):839-53 [PMID: 22105350]
  5. J Biol Chem. 2012 Mar 30;287(14):11037-48 [PMID: 22334673]
  6. Oncogene. 1999 Dec 2;18(51):7370-7 [PMID: 10602493]
  7. Annu Rev Immunol. 2008;26:389-420 [PMID: 18304003]
  8. EMBO J. 2005 Dec 21;24(24):4279-90 [PMID: 16341093]
  9. EMBO J. 1996 Dec 16;15(24):7013-25 [PMID: 9003777]
  10. Signal Transduct Target Ther. 2021 Dec 13;6(1):412 [PMID: 34897277]
  11. Genes Dev. 1996 Sep 15;10(18):2251-64 [PMID: 8824585]
  12. J Biol Chem. 2001 Jun 1;276(22):18908-14 [PMID: 11279207]
  13. J Biol Chem. 2001 May 4;276(18):14675-84 [PMID: 11278403]
  14. Curr Cancer Drug Targets. 2007 Feb;7(1):55-70 [PMID: 17305478]
  15. Nat Immunol. 2007 Jan;8(1):84-91 [PMID: 17115060]
  16. Adv Mater. 2025 Jan;37(3):e2411454 [PMID: 39568237]
  17. Cancer Cell. 2020 Oct 12;38(4):551-566.e11 [PMID: 32860752]
  18. PLoS One. 2020 Dec 3;15(12):e0243145 [PMID: 33270695]
  19. Cell Rep. 2018 Oct 2;25(1):80-94 [PMID: 30282040]
  20. Immunity. 2000 Apr;12(4):399-408 [PMID: 10795738]
  21. Blood. 2003 May 1;101(9):3687-9 [PMID: 12522005]
  22. Proc Natl Acad Sci U S A. 2009 Aug 25;106(34):14508-13 [PMID: 19706536]
  23. J Biol Chem. 2007 Nov 30;282(48):34693-9 [PMID: 17895239]
  24. J Med Chem. 2024 Nov 14;67(21):18682-18698 [PMID: 39446986]
  25. Mol Cell Biol. 2005 Mar;25(6):2364-83 [PMID: 15743830]

MeSH Term

Humans
Lymphocyte Activation
Protein Kinase Inhibitors
Jurkat Cells
Protein Serine-Threonine Kinases
T-Lymphocytes
Neoplasms
Immunotherapy
Receptors, Antigen, T-Cell

Chemicals

hematopoietic progenitor kinase 1
Protein Kinase Inhibitors
Protein Serine-Threonine Kinases
Receptors, Antigen, T-Cell

Word Cloud

Created with Highcharts 10.0.0HPK1kinasecellsTactivationcellJurkat1targetcancerimmunotherapysufficientfunctionhumancomparedprogenitorcompoundsstudygeneticusedHPK1-wildtypeactivityprimaryreceptorTCR-inducedinhibitorCompounddegraderBackground:Hematopoieticmembermitogen-activatedproteinMAP4KfamilyreportednegativelyregulatesSeveraldevelopedtestedclinicaltrialsHoweverwhetherinhibitioneliminateimmunosuppressiveparticularlyremainselusiveMethods:toolseditlymphocytelineHPK1-nullHPK1-kinase-inactiveectopicexpressionknockoutdirectmutationBesidesvalidationseriesselectivelywithoutHPK1-degradationassesspotentialscaffoldregulationcytotoxicResultsconclusion:AugmentedT-cellTCR-inducedHPK1-knockoutinhibitedcomplementationwildtypekinase-deadK46E-knockinK46*-knockinshowedcomparablelevelsenhancedcontrolSimilarlycereblon-basedCRBN-based2elicitedsimilardegreesmaximumperipheralbloodsummaryresultssuggestedmaytargetingmediatedinhibitor:approachmodulatedegraderssignalinghematopoieticnon-catalytic

Similar Articles

Cited By