Artificial-Intelligence Bio-Inspired Peptide for Salivary Detection of SARS-CoV-2 in Electrochemical Biosensor Integrated with Machine Learning Algorithms.

Marcelo Augusto Garcia-Junior, Bruno Silva Andrade, Ana Paula Lima, Iara Pereira Soares, Ana Flávia Oliveira Notário, Sttephany Silva Bernardino, Marco Fidel Guevara-Vega, Ghabriel Honório-Silva, Rodrigo Alejandro Abarza Munoz, Ana Carolina Gomes Jardim, Mário Machado Martins, Luiz Ricardo Goulart, Thulio Marquez Cunha, Murillo Guimarães Carneiro, Robinson Sabino-Silva
Author Information
  1. Marcelo Augusto Garcia-Junior: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil. ORCID
  2. Bruno Silva Andrade: Department of Biological Sciences, Laboratory of Bioinformatics and Computational Chemistry, State University of Southwest of Bahia (UESB), Jequié 45205-490, Brazil. ORCID
  3. Ana Paula Lima: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil.
  4. Iara Pereira Soares: Post-Graduation Program in Genetics and Biochemistry, Laboratory of Nanobiotechnology-Dr Luiz Ricardo Goulart, Federal University of Uberlândia (UFU), Uberlândia 38408-100, Brazil.
  5. Ana Flávia Oliveira Notário: Post-Graduation Program in Genetics and Biochemistry, Laboratory of Nanobiotechnology-Dr Luiz Ricardo Goulart, Federal University of Uberlândia (UFU), Uberlândia 38408-100, Brazil.
  6. Sttephany Silva Bernardino: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil.
  7. Marco Fidel Guevara-Vega: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil.
  8. Ghabriel Honório-Silva: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil.
  9. Rodrigo Alejandro Abarza Munoz: Institute of Chemistry, Federal University of Uberlândia (UFU), Uberlândia 38408-100, Brazil. ORCID
  10. Ana Carolina Gomes Jardim: Institute of Biosciences, Languages, and Exact Sciences (Ibilce), São Paulo State University (Unesp), São José do Rio Preto 15054-000, Brazil. ORCID
  11. Mário Machado Martins: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil. ORCID
  12. Luiz Ricardo Goulart: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil. ORCID
  13. Thulio Marquez Cunha: Department of Pulmonology, School of Medicine, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil.
  14. Murillo Guimarães Carneiro: Faculty of Computing, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil. ORCID
  15. Robinson Sabino-Silva: Department of Physiology, Laboratory of Nanobiotechnology-Dr. Luiz Ricardo Goulart, Innovation Center in Salivary Diagnostic and Nanobiotechnology, Institute of Biomedical Sciences, Federal University of Uberlandia (UFU), Uberlândia 38408-100, Brazil.

Abstract

Developing affordable, rapid, and accurate biosensors is essential for SARS-CoV-2 surveillance and early detection. We created a bio-inspired peptide, using the SAGAPEP AI platform, for COVID-19 salivary diagnostics via a portable electrochemical device coupled to Machine Learning algorithms. SAGAPEP enabled molecular docking simulations against the SARS-CoV-2 Spike protein's RBD, leading to the synthesis of Bio-Inspired Artificial Intelligence Peptide 1 (BIAI1). Molecular docking was used to confirm interactions between BIAI1 and SARS-CoV-2, and BIAI1 was functionalized on rhodamine-modified electrodes. Cyclic voltammetry (CV) using a [Fe(CN)] solution detected virus levels in saliva samples with and without SARS-CoV-2. Support vector machine (SVM)-based machine learning analyzed electrochemical data, enhancing sensitivity and specificity. Molecular docking revealed stable hydrogen bonds and electrostatic interactions with RBD, showing an average affinity of -250 kcal/mol. Our biosensor achieved 100% sensitivity, 80% specificity, and 90% accuracy for 1.8 × 10⁴ focus-forming units in infected saliva. Validation with COVID-19-positive and -negative samples using a neural network showed 90% sensitivity, specificity, and accuracy. This BIAI1-based electrochemical biosensor, integrated with machine learning, demonstrates a promising non-invasive, portable solution for COVID-19 screening and detection in saliva.

Keywords

References

  1. Sci Rep. 2024 Sep 16;14(1):21546 [PMID: 39278957]
  2. FEBS J. 2023 Jun;290(12):3089-3104 [PMID: 35490403]
  3. Biosensors (Basel). 2023 Sep 13;13(9): [PMID: 37754118]
  4. Anal Chim Acta. 2022 May 1;1205:339739 [PMID: 35414399]
  5. Med Res Rev. 2020 Jul;40(4):1276-1314 [PMID: 31922268]
  6. Lancet. 2020 Feb 22;395(10224):565-574 [PMID: 32007145]
  7. Clin Chem Lab Med. 2021 Dec 16;60(3):338-342 [PMID: 34911171]
  8. J Infect Chemother. 2021 Feb;27(2):384-386 [PMID: 33397587]
  9. Sensors (Basel). 2022 May 12;22(10): [PMID: 35632090]
  10. Anal Bioanal Chem. 2023 Jul;415(18):3683-3692 [PMID: 36637495]
  11. Periodontol 2000. 2016 Feb;70(1):38-52 [PMID: 26662481]
  12. Adv Mater. 2022 Jul;34(30):e2201085 [PMID: 35288985]
  13. ACS Sens. 2021 Mar 26;6(3):593-612 [PMID: 33544999]
  14. Struct Chem. 2023 Jan 25;:1-14 [PMID: 36714014]
  15. Front Chem. 2022 Jun 13;10:911678 [PMID: 35769443]
  16. Nat Commun. 2021 Feb 5;12(1):802 [PMID: 33547323]
  17. ACS Sens. 2020 Feb 28;5(2):431-439 [PMID: 32077684]
  18. Anal Chem. 2021 Oct 5;93(39):13360-13372 [PMID: 34553924]
  19. Proteins. 2012 Aug;80(9):2154-68 [PMID: 22544824]
  20. Signal Transduct Target Ther. 2022 Jan 27;7(1):26 [PMID: 35087058]
  21. Phys Chem Chem Phys. 2016 Oct 19;18(41):28418-28427 [PMID: 27757449]
  22. RSC Adv. 2021 Jan 19;11(7):3816-3826 [PMID: 35424358]
  23. ACS Sens. 2024 Apr 26;9(4):1978-1991 [PMID: 38564767]
  24. Methods Mol Biol. 2024;2714:329-352 [PMID: 37676607]
  25. Sensors (Basel). 2020 Jan 23;20(3): [PMID: 31979213]
  26. Jpn Dent Sci Rev. 2023 Jun 21;: [PMID: 37360001]
  27. J Physiol Pharmacol. 2021 Aug;72(4): [PMID: 34987123]
  28. J Pharm Biomed Anal. 2021 Nov 30;206:114392 [PMID: 34607201]
  29. Nanotechnology. 2021 Sep 20;32(50): [PMID: 34433151]
  30. Biomater Sci. 2023 Jul 25;11(15):5251-5261 [PMID: 37341479]
  31. J Microbiol Methods. 2009 Jul;78(1):10-9 [PMID: 19394369]
  32. Infect Dis (Lond). 2021 Oct;53(10):737-754 [PMID: 34024217]
  33. Anal Chem. 2000 Aug 1;72(15):3486-91 [PMID: 10952532]
  34. PeerJ. 2020 Oct 7;8:e10180 [PMID: 33083156]
  35. Appl Microbiol Biotechnol. 2021 Jan;105(2):441-455 [PMID: 33394144]
  36. Chem Eng J. 2022 Feb 15;430:132966 [PMID: 34690533]
  37. Biosens Bioelectron. 2009 Oct 15;25(2):469-74 [PMID: 19729294]
  38. J Med Microbiol. 2021 Feb;70(2): [PMID: 33270005]
  39. Anal Chem. 2018 Jun 19;90(12):7777-7783 [PMID: 29790331]
  40. Sensors (Basel). 2017 Nov 03;17(11): [PMID: 29099764]
  41. Sci Rep. 2021 Apr 7;11(1):7567 [PMID: 33828178]
  42. Angew Chem Int Ed Engl. 2008;47(50):9752-5 [PMID: 18989870]
  43. Nucleic Acids Res. 2021 Jul 2;49(W1):W530-W534 [PMID: 33950214]
  44. Chem Commun (Camb). 2010 Jan 21;46(3):395-7 [PMID: 20066303]
  45. Nat Rev Mater. 2021;6(8):650 [PMID: 34226850]
  46. J Am Chem Soc. 2022 Aug 3;144(30):13526-13537 [PMID: 35858825]
  47. J Proteome Res. 2013 Apr 5;12(4):1700-9 [PMID: 23406527]
  48. Viruses. 2023 Sep 06;15(9): [PMID: 37766292]
  49. Bioorg Med Chem. 2018 Jun 1;26(10):2708-2718 [PMID: 28728899]
  50. Elife. 2021 Jun 30;10: [PMID: 34190045]
  51. J Clin Lab Anal. 2021 Aug;35(8):e23876 [PMID: 34132419]
  52. Sci Afr. 2023 Sep;21:e01757 [PMID: 37351482]
  53. Biomicrofluidics. 2020 Dec 11;14(6):061506 [PMID: 33343782]
  54. Nucleic Acids Res. 2018 Jul 2;46(W1):W443-W450 [PMID: 29746661]
  55. Molecules. 2023 Apr 27;28(9): [PMID: 37175186]
  56. Biosens Bioelectron. 2013 Nov 15;49:531-5 [PMID: 23816850]
  57. ACS Sens. 2022 Jun 24;7(6):1740-1746 [PMID: 35616064]

Grants

  1. #23038.014934/2020-59/Coordenação de Aperfeicoamento de Pessoal de Nível Superior
  2. #458143/2014/Coordenação de Aperfeicoamento de Pessoal de Nível Superior
  3. #406840/2022-9/National Council for Scientific and Technological Development
  4. #465669/2014-0/National Council for Scientific and Technological Development
  5. #APQ-02872-16/Fundação de Amparo à Pesquisa do Estado de Minas Gerais
  6. #APQ-00476-20/Fundação de Amparo à Pesquisa do Estado de Minas Gerais
  7. #APQ-02148-21/Fundação de Amparo à Pesquisa do Estado de Minas Gerais
  8. #APQ-03613-17/Fundação de Amparo à Pesquisa do Estado de Minas Gerais

MeSH Term

Biosensing Techniques
Humans
Saliva
SARS-CoV-2
Molecular Docking Simulation
COVID-19
Spike Glycoprotein, Coronavirus
Electrochemical Techniques
Artificial Intelligence
Peptides
Machine Learning
Support Vector Machine

Chemicals

Spike Glycoprotein, Coronavirus
spike protein, SARS-CoV-2
Peptides

Word Cloud

Created with Highcharts 10.0.0SARS-CoV-2electrochemicaldetectionusingCOVID-19dockingBIAI1salivamachinesensitivityspecificitybiosensorsbio-inspiredSAGAPEPsalivarydiagnosticsportableMachineLearningRBDBio-InspiredPeptide1Molecularinteractionssolutionsampleslearningbiosensor90%accuracyDevelopingaffordablerapidaccurateessentialsurveillanceearlycreatedpeptideAIplatformviadevicecoupledalgorithmsenabledmolecularsimulationsSpikeprotein'sleadingsynthesisArtificialIntelligenceusedconfirmfunctionalizedrhodamine-modifiedelectrodesCyclicvoltammetryCV[FeCN]detectedviruslevelswithoutSupportvectorSVM-basedanalyzeddataenhancingrevealedstablehydrogenbondselectrostaticshowingaverageaffinity-250kcal/molachieved100%80%8×10⁴focus-formingunitsinfectedValidationCOVID-19-positive-negativeneuralnetworkshowedBIAI1-basedintegrateddemonstratespromisingnon-invasivescreeningArtificial-IntelligenceSalivaryDetectionElectrochemicalBiosensorIntegratedAlgorithmsartificialintelligencepeptides

Similar Articles

Cited By

No available data.