Single-molecule measurements of bacteriophage lambda DNA packaging using purified terminase motor proteins and E. coli integration host factor.

Brandon Rawson, Qin Yang, Carlos E Catalano, Douglas E Smith
Author Information
  1. Brandon Rawson: Department of Physics, University of California, San Diego, La Jolla, CA, 92093, USA.
  2. Qin Yang: Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of Colorado Denver, Anschutz Medical Campus, Aurora, CO, 80045, USA.
  3. Carlos E Catalano: Department of Pharmaceutical Sciences, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of Colorado Denver, Anschutz Medical Campus, Aurora, CO, 80045, USA.
  4. Douglas E Smith: Department of Physics, University of California, San Diego, La Jolla, CA, 92093, USA. des@ucsd.edu.

Abstract

Biomotor-driven DNA packaging is a key step in the life cycle of many viruses. We previously developed single-molecule methods using optical tweezers to measure packaging dynamics of the bacteriophage lambda motor. The lambda system is more complex than others examined via single-molecule assays with respect to the packaging substrate and ancillary proteins required. Because of this, previous studies which efficiently detected packaging events used crude E. coli cell extracts containing host factors and the terminase packaging enzyme. However, use of extracts is suboptimal for biochemical manipulation and obfuscates interrogation of additional factors that affect the process. Here we describe an optical tweezers assay using purified lambda terminase holoenzyme. Packaging events are as efficient as with crude extracts, but only if purified E. coli integration host factor (IHF) is included in the motor assembly reactions. We find that the ATP-driven DNA translocation dynamics, motor force generation, and motor-DNA interactions without nucleotide are virtually identical to those measured with extracts. Thus, single-molecule packaging activity can be fully recapitulated in a minimal system containing only purified lambda procapsids, purified terminase, IHF, and ATP. This sets the stage for single-molecule studies to investigate additional phage proteins known to play essential roles in the packaging reaction.

Keywords

References

  1. Biopolymers. 1978 Mar;17(3):785-94 [PMID: 638234]
  2. Biochemistry. 2006 Dec 26;45(51):15259-68 [PMID: 17176048]
  3. Curr Opin Virol. 2011 Aug;1(2):134-41 [PMID: 22440623]
  4. Biophys J. 2006 Dec 1;91(11):4253-7 [PMID: 16963512]
  5. Nucleic Acids Res. 2019 Feb 20;47(3):1404-1415 [PMID: 30541105]
  6. Nucleic Acids Res. 2022 Aug 26;50(15):8719-8732 [PMID: 35947691]
  7. Annu Rev Genet. 2008;42:647-81 [PMID: 18687036]
  8. Protein Cell. 2020 May;11(5):374-379 [PMID: 32266588]
  9. Biophys J. 2017 Apr 25;112(8):1551-1560 [PMID: 28445747]
  10. Methods Mol Biol. 2018;1805:393-422 [PMID: 29971729]
  11. Methods Enzymol. 2009;463:3-6 [PMID: 19892161]
  12. J Mol Biol. 2019 Nov 8;431(22):4455-4474 [PMID: 31473160]
  13. Virology. 1987 Dec;161(2):305-14 [PMID: 2961121]
  14. Biochemistry. 2012 Jan 10;51(1):391-400 [PMID: 22191393]
  15. Adv Virus Res. 2002;58:255-94 [PMID: 12205781]
  16. Proc Natl Acad Sci U S A. 2007 Oct 23;104(43):16868-73 [PMID: 17942694]
  17. Biochemistry. 2005 Jul 19;44(28):9645-56 [PMID: 16008350]
  18. J Mol Biol. 2008 Nov 28;383(5):1037-48 [PMID: 18801370]
  19. J Mol Biol. 2016 Jul 3;428(13):2709-29 [PMID: 27139643]
  20. Annu Rev Virol. 2015 Nov;2(1):351-78 [PMID: 26958920]
  21. Proc Natl Acad Sci U S A. 2019 Feb 26;116(9):3556-3561 [PMID: 30737287]
  22. J Mol Biol. 2007 Nov 9;373(5):1113-22 [PMID: 17919653]
  23. Biochemistry. 1993 Nov 16;32(45):11992-7 [PMID: 8218275]
  24. J Mol Biol. 2006 Nov 3;363(4):786-99 [PMID: 16987527]
  25. Nat Commun. 2018 Dec 21;9(1):5434 [PMID: 30575768]
  26. Nucleic Acids Res. 2020 May 21;48(9):5006-5015 [PMID: 32255177]
  27. Nucleic Acids Res. 2024 Jan 25;52(2):831-843 [PMID: 38084901]
  28. J Mol Biol. 2006 Apr 7;357(4):1154-66 [PMID: 16476446]
  29. Nature. 2001 Oct 18;413(6857):748-52 [PMID: 11607035]
  30. Nat Rev Microbiol. 2011 Aug 12;9(9):647-57 [PMID: 21836625]
  31. Biochemistry. 1999 Nov 2;38(44):14624-30 [PMID: 10545186]
  32. Enzymes. 2021;50:369-413 [PMID: 34861943]
  33. Virology. 2003 Jan 20;305(2):276-87 [PMID: 12573573]
  34. Proc Natl Acad Sci U S A. 2003 Aug 5;100(16):9292-5 [PMID: 12881484]
  35. Trends Microbiol. 2011 Dec;19(12):606-13 [PMID: 22000206]
  36. Phys Chem Chem Phys. 2009 Dec 7;11(45):10553-64 [PMID: 20145801]
  37. J Biol Chem. 2006 Sep 1;281(35):25635-43 [PMID: 16807240]

Grants

  1. R01 GM127365/NIGMS NIH HHS

MeSH Term

Bacteriophage lambda
DNA Packaging
Endodeoxyribonucleases
Escherichia coli
Integration Host Factors
DNA, Viral
Single Molecule Imaging
Optical Tweezers
Virus Assembly

Chemicals

terminase
Endodeoxyribonucleases
Integration Host Factors
DNA, Viral

Word Cloud

Created with Highcharts 10.0.0packaginglambdamotorpurifiedDNAsingle-moleculeextractsterminaseusingtweezersproteinsEcolihostopticaldynamicsbacteriophagesystemstudieseventscrudecontainingfactorsadditionalholoenzymeintegrationfactorIHFSingle-moleculeBiomotor-drivenkeysteplifecyclemanyvirusespreviouslydevelopedmethodsmeasurecomplexothersexaminedviaassaysrespectsubstrateancillaryrequiredpreviousefficientlydetectedusedcellenzymeHoweverusesuboptimalbiochemicalmanipulationobfuscatesinterrogationaffectprocessdescribeassayPackagingefficientincludedassemblyreactionsfindATP-driventranslocationforcegenerationmotor-DNAinteractionswithoutnucleotidevirtuallyidenticalmeasuredThusactivitycanfullyrecapitulatedminimalprocapsidsATPsetsstageinvestigatephageknownplayessentialrolesreactionmeasurementsMolecularOpticalbiophysicsTerminaseViral

Similar Articles

Cited By