Difference between revisions of "Os08g0524100"

From RiceWiki
Jump to: navigation, search
(Structured Information)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD(+)-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions.OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1. Our data together suggest that the rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth, but likely implicates different molecular mechanisms than yeast and animal homologs.
+
The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD(+)-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions.OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1.The rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth, but likely implicates different molecular mechanisms than yeast and animal homologs.
  
 
===Expression===
 
===Expression===

Revision as of 02:57, 26 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The SILENT INFORMATION REGULATOR2 (SIR2) family proteins are NAD(+)-dependent histone deacetylases. Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions.OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues. OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress. Transcript microarray analysis revealed that the transcription of many transposons and retrotransposons in addition to genes related to hypersensitive response and/or programmed cell death was activated. Chromatin immunoprecipitation assays showed that OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1.The rice SIR2-like gene is required for safeguard against genome instability and cell damage to ensure plant cell growth, but likely implicates different molecular mechanisms than yeast and animal homologs.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os08g0524100

Description

Similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase 12 (EC 3.1.3.36) (At5PTase12) (FRAGILE FIBER3 protein)

Version

NM_001068820.1 GI:115477377 GeneID:4346083

Length

7362 bp

Definition

Oryza sativa Japonica Group Os08g0524100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 Huang, LM(Huazhong Agr Univ, Natl Key Lab Crop Genet Improvement, Wuhan 430070, Peoples R China);Sun, QW(Mil Econ Acad, Dept quartermaster, Wuhan 430035, Peoples R China);Qin, FJ(Univ Paris 11, Inst Biol Biotechnol, F-91405 Orsay, France);Li, CZhao, Y;Zhou, DX          clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:26150471..26157832

Sequence Coding Region

26150586..26151303,26152182..26152434,26152524..26153328,26154075..26154199,26154328..26154412
,26154720..26154873,26154971..26155008,26155089..26155356,26155504..26155627
,26155755..26156115,26157151..26157543

Expression

GEO Profiles:Os08g0524100

Genome Context

<gbrowseImage1> name=NC_008401:26150471..26157832 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:26150471..26157832 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggactcggacgacgaggcggcggctgcggccatggcggcgcgggcgcgggagacgctgaggaagagcgcgtcgtcgtcgtcgtcgtcgccgtacgcgcgtagcaccgacgacggccccgtcgcctccgcctcgtgcgacgcgcgcctcgagcgctgctgccgcgaggttggcgccgcggtggcggtggtggaggagccggagcgggttgtttcggggggcggggcgttgccggagtttgttggtgagggagggggcgaggggatctaccgggtgccgctgcgcgccgcgatgcacccgggccgcccgccgccgctcgaggtgcggccccacccgctgcgggagacgcaggtggggtccttcctgcgggcgctggcgtgcgagccgcggcgccggcagctctgggcgggctccgagtccggggtccgcgtgtgggggctcgacgacgtgttcgccgccgccgggtgcggggcgcgccgcggcgacgaggagagcgcgcccttcagggagtccgtgcccgtgccgcccgtgctctgcgtcgaggcggacgcctcgaacgcgctggtgtggacgggccacaaggatgggaggatcatgtcgtggcgaatggacctcgccgccggcagcgacgacgatgacgcgccgttgttcagggaggccctgacgtggcaggcacacagccgcacgccagtgctctccatggtcatcacgtcttatggtgaaatatggtcaggatccgaagggggtgttataaaggcatggccctgggacgtcattgctaagtccctctcactaatgccagaagaaaaacatgtggctgctttacggattgaaaggtcatatattgaccttaggaacaatgcagcagctggcaacatatcttcgttccccgctgctgatgtgaaacacatgcttgctgaccattcccgggcaaaagtttggtgtttaactagcatggcatttgctgtttgggatgctcggaccagggaactgctaaaagtgtttggcatggacggccaaattgagtcagctcggttagaggcacctgtgatgccagagcaatttatagaggaagaaatcaaagcaaaacccgtgaagaaggataaaccacaaagctctttcaattttttccagaaatcaaggaatgccctgatgggagcagctggtgcagtacgcagagttgctacaaaagggacatttgttgaagataatcgccgaacagaagcagtggttcaggcaatgaatggaacggtttggtcaggttgcacagatggtttgatcattatgtgggatggaaatgggaaccgactgcaagaattccagcatcattgttcttctgttcagtgcatgaaggcacttggagaaagggtgtgggtgggctatgccagtggcattattcaagtcatggatgtggaaggtaaccttctggcagaatggactgggcatagctgtccggtcatacagatggcgattggtggttcttatgtctttactcttgctcatcatggtggaattagaggatggcctctagcttcccctggccctctggatgatattctgcgaactgaattgtcaaacagggagttgtcgtatagaaggctagtgaacattaaaatgcttgttgggacttggaatgttggccaggagaaagcatcttatgaatcactcatgtcatggttgggtcgtgcattttttgatgttgacttggtggtggttggtctacaagaggtcgagatgggtgctggtgttcttgccatggctgcagccaaagaaagtgtagggcttgagggtagtgccaatggtcagtggtggatagacaatattggcaggacccttgatgaggggatatccttccaccgagttggttcaaggcagctggctggattacttattgctgcatgggcaaggaaggaccttaagccacatgttggtgatgttgatgctgctgcagtaccatgtggctttgggcgtgctattggcaacaagggtggtgtagggttaagaattagagtctatgatcgcaggatatgttttgtgaacaatcattttgctgcacatctagaaaatgttagccgtcgtaatgctgattttgatcatatctatcgaacgatgacttttaacaaacctcatggatctgcagcttctgctacatctgttcaattgcataaaaccgtgaatgccaatggaaatcaggtcgatgaagatatacctgagatggcagaagctgatatggttgtctttcttggtgatttcaactaccgactttacggtatcacctatgatgaagcaagggacatggtctctcaaaggagctttgactggcttaaagaaagggatcaacttcaagcagaaatgagggcaggaaaggttttccaaggaatgcgtgaaggtttgatcagatttcctccgacttacaaattccaaagacacctaccaggtcttgcaggatatgactcgggtgagaagaagagaatacctgcttggtgcgacagaatactgtatcgagatagccgtgatgtattaacagcagagtgctcattagaatgccctgttgttgctaaaattacatcgtatgaagcttgcatgggtgtcacagatagtgatcataaaccagtgaggtgtgcatttagtgttgatattgcaagagtggatgagtttacaagaagacaggaatatggaaaaatactccaatctgacaaaagattacacagtttgcttcgagagtcccattttgttccagacactataatcagcacaaacaatataattttggaaaaccaagaacatgttgtcctccggataacaaatgattgtcaaagaaacaaggctgcttttgaaatcctgtgtgaaagccagtcaatcagcaagcaggatggaactaaatccgagtttcctccaagggcatcctttgggttgccgctttggcttgaggttgaaccatcagttggtctcattgaacctgggcaaacaatggaagttaccgtgcaccatgaagactattacacccaagaagtatttgtcaatggagtactgcagaactgttggtgcgaagtcaccagagataaggaggccgttcttttggtcaatgtaacaggtagcacctcaactgaaaccattacacacaggatcaatgtcaggcattgctgctcaacgatttctgcatccccgcccatcaatccaccgtctatcacaaccccatccgttgatgttctatcgggtgaagcatctacaagaagttcaaagaagaatccgttgaattatttgcaacgttctgactttaagccattcggcagctcagaggtgcatgatttgtgccccttgtga</cdnaseq>

Protein Sequence

<aaseq>MDSDDEAAAAAMAARARETLRKSASSSSSSPYARSTDDGPVASA SCDARLERCCREVGAAVAVVEEPERVVSGGGALPEFVGEGGGEGIYRVPLRAAMHPGR PPPLEVRPHPLRETQVGSFLRALACEPRRRQLWAGSESGVRVWGLDDVFAAAGCGARR GDEESAPFRESVPVPPVLCVEADASNALVWTGHKDGRIMSWRMDLAAGSDDDDAPLFR EALTWQAHSRTPVLSMVITSYGEIWSGSEGGVIKAWPWDVIAKSLSLMPEEKHVAALR IERSYIDLRNNAAAGNISSFPAADVKHMLADHSRAKVWCLTSMAFAVWDARTRELLKV FGMDGQIESARLEAPVMPEQFIEEEIKAKPVKKDKPQSSFNFFQKSRNALMGAAGAVR RVATKGTFVEDNRRTEAVVQAMNGTVWSGCTDGLIIMWDGNGNRLQEFQHHCSSVQCM KALGERVWVGYASGIIQVMDVEGNLLAEWTGHSCPVIQMAIGGSYVFTLAHHGGIRGW PLASPGPLDDILRTELSNRELSYRRLVNIKMLVGTWNVGQEKASYESLMSWLGRAFFD VDLVVVGLQEVEMGAGVLAMAAAKESVGLEGSANGQWWIDNIGRTLDEGISFHRVGSR QLAGLLIAAWARKDLKPHVGDVDAAAVPCGFGRAIGNKGGVGLRIRVYDRRICFVNNH FAAHLENVSRRNADFDHIYRTMTFNKPHGSAASATSVQLHKTVNANGNQVDEDIPEMA EADMVVFLGDFNYRLYGITYDEARDMVSQRSFDWLKERDQLQAEMRAGKVFQGMREGL IRFPPTYKFQRHLPGLAGYDSGEKKRIPAWCDRILYRDSRDVLTAECSLECPVVAKIT SYEACMGVTDSDHKPVRCAFSVDIARVDEFTRRQEYGKILQSDKRLHSLLRESHFVPD TIISTNNIILENQEHVVLRITNDCQRNKAAFEILCESQSISKQDGTKSEFPPRASFGL PLWLEVEPSVGLIEPGQTMEVTVHHEDYYTQEVFVNGVLQNCWCEVTRDKEAVLLVNV TGSTSTETITHRINVRHCCSTISASPPINPPSITTPSVDVLSGEASTRSSKKNPLNYL QRSDFKPFGSSEVHDLCPL</aaseq>

Gene Sequence

<dnaseqindica>116..833#1712..1964#2054..2858#3605..3729#3858..3942#4250..4403#4501..4538#4619..4886#5034..5157#5285..5645#6681..7073#atcgccatcgacgacgacgacgacgagctcgcctccccttcccttccctccacggcgcgccgcctccgcgacaggtcaccctcttcccttccatccaaacgagctcggatttaggatggactcggacgacgaggcggcggctgcggccatggcggcgcgggcgcgggagacgctgaggaagagcgcgtcgtcgtcgtcgtcgtcgccgtacgcgcgtagcaccgacgacggccccgtcgcctccgcctcgtgcgacgcgcgcctcgagcgctgctgccgcgaggttggcgccgcggtggcggtggtggaggagccggagcgggttgtttcggggggcggggcgttgccggagtttgttggtgagggagggggcgaggggatctaccgggtgccgctgcgcgccgcgatgcacccgggccgcccgccgccgctcgaggtgcggccccacccgctgcgggagacgcaggtggggtccttcctgcgggcgctggcgtgcgagccgcggcgccggcagctctgggcgggctccgagtccggggtccgcgtgtgggggctcgacgacgtgttcgccgccgccgggtgcggggcgcgccgcggcgacgaggagagcgcgcccttcagggagtccgtgcccgtgccgcccgtgctctgcgtcgaggcggacgcctcgaacgcgctggtgtggacgggccacaaggatgggaggatcatgtcgtggcgaatggacctcgccgccggcagcgacgacgatgacgcgccgttgttcagggaggccctgacgtggcaggcacacagccgcacgccagtgctctccatggtcatcacgtcttatggtgagaagcttgattacttactttgatcatctcaatcaattctatttttcattgagcaaattacgcaagggatggataaaaattggctccgtgcatagtgaggcaatagcattattgggtaaaagagcacgaagaatgattttagctgatgaaatgtttcattttagctgattttaagcgtctgaaaataacagggctttagcaacaactttagtctattacaaataaattaggaaaaacacttttggggggtggggtccagtaatattgacatcttgcaaatggaaaatctgaaagttgaactagtttttttttttctgttctgtatgacatgacatccatatatgggagtattagtgttagaagttttctcaaatggtaggcttccgttatcttttttagatgcgtttgcatggatgtaatcacttgggcgcgtttttctctttgcataaatgtggagaagtttgggaaggtaaaagtaacctaaaaaacatccacaaacaataggattagcctacgaaatgaacactcataccatagagaactttatcgaataatacaaataaatccttgttattcttgaaatattaagaaactgtctgttaataattgaagtcttaaagttcacttgtgttttagttgtctactatgtgaaaagcctacttggaagatgctttattgttgttccttttgaaacttaattttcagctttatttgttgcattggatcgctgtcaatggctgaatcattcattcgtagttatatgacattaaggcatctcttctgctccatacaagatttaaacttcacaatgtccactaaaagaggtagaacgttttgcaaaaatgatttatttcatttcaatatcttggaaacaggtgaaatatggtcaggatccgaagggggtgttataaaggcatggccctgggacgtcattgctaagtccctctcactaatgccagaagaaaaacatgtggctgctttacggattgaaaggtcatatattgaccttaggaacaatgcagcagctggcaacatatcttcgttccccgctgctgatgtgaaacacatgcttgctgaccattcccgggcaaaagtttggtgtttaactagcatggcatttgctgtttggtatgctttcataaataaattgcattatccttgagttcatcggcccattgaaaagttaggaactattttttctgatatttttcctgtagggatgctcggaccagggaactgctaaaagtgtttggcatggacggccaaattgagtcagctcggttagaggcacctgtgatgccagagcaatttatagaggaagaaatcaaagcaaaacccgtgaagaaggataaaccacaaagctctttcaattttttccagaaatcaaggaatgccctgatgggagcagctggtgcagtacgcagagttgctacaaaagggacatttgttgaagataatcgccgaacagaagcagtggttcaggcaatgaatggaacggtttggtcaggttgcacagatggtttgatcattatgtgggatggaaatgggaaccgactgcaagaattccagcatcattgttcttctgttcagtgcatgaaggcacttggagaaagggtgtgggtgggctatgccagtggcattattcaagtcatggatgtggaaggtaaccttctggcagaatggactgggcatagctgtccggtcatacagatggcgattggtggttcttatgtctttactcttgctcatcatggtggaattagaggatggcctctagcttcccctggccctctggatgatattctgcgaactgaattgtcaaacagggagttgtcgtatagaaggctagtgaacattaaaatgcttgttgggacttggaatgttggccaggagaaagcatcttatgaatcactcatgtcatggttgggtcgtgcattttttgatgttgacttggtggtggttggtctacaagaggtcgagatgggtgctggtgttcttgccatggctgcagccaaagaaagtgtaagatatgaaatactcaaccctacctttgatttcgttgtttcattgttttcttgctcggttcaatcaaggaaaaagaaactattattgagataggaaaataggttactagtgagcacaataagattatttctgcattacagcttaatttgtattatttctgataatatgactgtatctgcgctactgtcttttgaaaaacacaagtggtgtgcttgtctttctgataaaatggttgtactatgttacattttaatttttatccttcttatctctatctggagctcatatgattctaatttagctgcttgaaacaaatactgcatatacctaagcataagggttcattctagagctctaggtgcagattacctttttacagttttttttttgtgagaaggcacaggagaactgtgtatatttctgttagtataaaaatgatgaacactgaaactgaagttaagagttgtcttttacagttattgcagctgtatgtttgggaagtcaatgcatttgctttcatgctagtttgtttgctgtggtgttttattggtataataaagctaccactgagaactggaaggaaaatttaatttaatttcctatctggtcatcatctcccccttcttcctgtttctgtctgattttcatatctagactgcactgggctatttcctgtactggtatcatgcctgctatgtgagttttgagcattttattcaacatttcttgctttatggccttaggtagggcttgagggtagtgccaatggtcagtggtggatagacaatattggcaggacccttgatgaggggatatccttccaccgagttggttcaaggcagctggctggattacttattgctgcatggtactggtttatcttaaaaccatttcttagtgaaacatttttctgttattatataattatcattttttttgcacttttgtacttttctcatacgatatgtatggcatgtacatcatgataatttcaagggcaaggaaggaccttaagccacatgttggtgatgttgatgctgctgcagtaccatgtggctttgggcgtgctattggcaacaaggtacatgattgtcaaaatgtttattaactgtttgttcttgagcgtatcatatgtgcactataccaactgggaatttcgttcacgcaaagaacattatactgctgtgataaataatcatgggatactcaaaatatgtttttcttcacatacttcatccaactagaaacaatttgtgagcgtgcaatggttagaggtgaaagtgtgcagctgcagttttcagaggaaaattattttaatagttagcaatatattgctctattctttttcctattttgcattgaataatgatatctcattcttcttgcagggtggtgtagggttaagaattagagtctatgatcgcaggatatgttttgtgaacaatcattttgctgcacatctagaaaatgttagccgtcgtaatgctgattttgatcatatctatcgaacgatgacttttaacaaacctcatggatctgcaggtacttcattctcaactttcatcttataagtatatttaaatactagtttgttgtaaatgaattctataacatcttttttttttggtttcctctacagcttctgctacatctgttcaattgcataaaaccgtgaatgtatgtaatcgctgaactgcattgcagatttttccgtggaaataaagaatacttatttatagctattgtcataatggcaggccaatggaaatcaggtcgatgaagatatacctgagatggcagaagctgatatggttgtctttcttggtgatttcaactaccgactttacggtatcacctatgatgaagcaagggacatggtctctcaaaggagctttgactggcttaaagaaagggatcaacttcaagcagaaatgagggcaggaaaggttttccaaggaatgcgtgaaggtttgatcagatttcctccgacttacaaattccaaagacacctaccaggtcttgcaggtatggcctgtttttacttttgatgctagcggcacctccttaattaaatagttccagttctgtcacaagattcaaatgttcttttatgtgctgattaaattgacgcaactgctttggagctaatttttccacaccaaaaataattaggatatgactcgggtgagaagaagagaatacctgcttggtgcgacagaatactgtatcgagatagccgtgatgtattaacagcagagtgctcattagaatgccctgttgttgctaaaattacatcgtaagattctacaacttaccagttaccactcgttttgagaaggagaatctaagacacacatgttgttttgtcttgatcataatcactccctcatacataatttgatgttttattgctcttctggtaggtatgaagcttgcatgggtgtcacagatagtgatcataaaccagtgaggtgtgcatttagtgttgatattgcaagagtggatgagtttacaagaagacaggaatatggaaaaatactccaatctgacaaaagattacacagtttgcttcgagagtcccattttgttccagacactataatcagcacaaacaatataattttggaaaaccaagaacatgttgtcctccggataacaaatgattgtcaaagaaacaaggctgcttttgaaatcctgtgtgaaagccagtcaatcagcaagcaggatggaactaaatccgagtttcctccaagggcatcctttgggttgccgctttggcttgaggtatgcattaatatgtttatttgtttattcctgcattcatttttttcttttgtttagtcttaaaacccattgtgtttttcccttattaagaaaaaagaaaacccatagtgttacactctcagttgagtgttctatttctatctgtagtgttgaccattcttttgcttgtatatagaaagcctgttaagttcaaaaccatagaaagtctgtccattatgtattcagtttgcaagacctaaaataaaatttagctcataaatatagaagatatcttgtcattctagaatatgaattttggacaaccatggaacctatatactcccctcacataatgtaaaagagaagggatggagtattttacttctatgacatgcactttctgtatcagctgcactccaacctctttgtgagaactatatcagactttcttttaattatgagaaagcaaactgaaggaaaaaaattgcaaaagcaaatgagatgaaacacaatttcgatcaccttgtacctagacagtcatggaggtgggctcaggtttggttgcatgtattgtcttctagtggtcatttaggatactctttgtggacatatatttggtcaaaatcataccaaactttgcatgagttgatagacaacatcatatgatcatatctgtcagtgctcagttcataaatgtgtttcagccaaaaatcctaatgcctcatttgcatgaacccaaatcctggcctatccacatctatgggctaggattttagctcaaattcccaacccatcccatacacgtggatgggctgccatttaacccatccatataagcctaaactggatatggatctcagtggagttgctgactgaccagtttgtcatgacagtcaacagacaagaacagctgctaccactaaccattcataacaagccttttgacttgagtgttatactagtttattatatttttcagtgctttgcatgttccattttgcttttcacagtaccaatatttggtaatttaatcattcatcgtgctatgttttacaggttgaaccatcagttggtctcattgaacctgggcaaacaatggaagttaccgtgcaccatgaagactattacacccaagaagtatttgtcaatggagtactgcagaactgttggtgcgaagtcaccagagataaggaggccgttcttttggtcaatgtaacaggtagcacctcaactgaaaccattacacacaggatcaatgtcaggcattgctgctcaacgatttctgcatccccgcccatcaatccaccgtctatcacaaccccatccgttgatgttctatcgggtgaagcatctacaagaagttcaaagaagaatccgttgaattatttgcaacgttctgactttaagccattcggcagctcagaggtgcatgatttgtgccccttgtgaaacatgtaaaaatgagtgtgtctgtgtgtttttgtctgtttggtgtagcagttctgtataggagttgagtcttacgttacttaccaaagggagaattaaggtgtcccactgttaattctgtagatattcaccactgacttctcaccattcgttgagtaacatcagaaaggaaatgtgtgcatagttacaagatatctcatgtagtttttttttttcctcttctttttatagaggacacatggtgatacaaaatattctttacaggttgaatacaaagaaagttacttcg</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0524100, RefSeq:Os08g0524100